CAZyme Information: Bcin04g06020.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin04g06020.1:RNA-p1
• CAZy Family: CE8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
987		108124.62	4.8132

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_4:2069815-2073288(-)

Full Sequence      

MRLLNIFTTLCLLLWGGAATNDGLTDVVEWDPYSLTVNGSRVFIFSAEFHYQRMPVPELW
LDIFQKFRANGFNTISVYFFWSYHEASKGSFDFETSGKNVQRVLDYAKEAGIWVIARAGP
YCNAETNAGGFALWGSDGSMGTLRSNNAAYYASWLPWITEIGGILAKNQITNGGPIILNQ
VENELQETTHSATNSLVLYMEQIEAAFRDVGITVPLSHNEKGQRSMSWSTDYQNVGGAVN
VYGLDSYPGGLSCTNPASGFNLVRNYYQWFSNYSYTQPSYFPEFESGYFTPWGGSFYDDC
ESELSPAFADVYYKNNIGQRTTLMSLYMAWGGTNWGHSAAPVVYSSYDYAAPLRETRQIR
DKLSQTKLIGLFTRVSTDLLKTEMIGNGTGYSVSSTGIWSWVLRNPDTQAGFTTVQQAKS
SSTTSVTFDVYLNTSLGAVTASNVNLNGRQSKILVTDYTFGKHTLLFSSADILTYGVFDV
DVLVLYLEEGQIGQFAFKTTSKLTYQVYGNSVFAANSTSNYTSTSQTFTYTQGSGQTVVK
FSDGALVYLLDQPSAWKFWAPATTSNPDVKPDEQIFVLGPYLVRNATTSSGVVNISGDVD
KTTNIEVFSGDSSIENIVWNGSPLSITKTKYGSYIAELSGTESRIVSLPQLTNWESANSL
PEKEISYDDSKWTVCNKTTTLSPIAPATLPVLFSSDYGYYTGPKIYRGYFDGSNYTSINI
TASGGLAFGWSAWLNGVLIGGNTGNATATTTNAILDLSTHTSIIKLTDNLITVVVDYHGH
DETSTAKGVENPRGILGASLLPKPSSSTGFKLWKIQGNAGGSANIDAVRGPMNEGGFYGE
RLGWHLPSSPSLSSKSTPLVGLNTSGISWYSTNFTLALDADLDVPLGIKFSAPAGTVARV
MFWINGYQYGKYVPHIGPQTVFPIPPGIINNRGENKLSISLWAMQDEGAKLDSVELVNYG
VYESGFGFSRDWSYLQPAWDSDRLQYA

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	35	369	2.2e-82	0.9869706840390879

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	7.95e-78	34	370	1	315	Glycosyl hydrolases family 35.
402180	BetaGal_dom2	7.03e-67	379	557	1	180	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C-terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N-terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, pfam01301, which is N-terminal to it, but itself has no metazoan members.
198097	BetaGal_dom2	9.90e-43	378	558	1	182	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyses the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, which is N-terminal to it, but itself has no metazoan members.
166698	PLN03059	1.20e-31	4	355	6	323	beta-galactosidase; Provisional
404274	BetaGal_dom4_5	5.41e-26	838	947	1	111	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ49456.1|GH35	0.0	1	987	1	987
CCD45102.2|GH35	0.0	1	987	1	987
APA12177.1|GH35	0.0	1	987	1	984
QSZ31820.1|GH35	0.0	1	987	1	983
UQC78589.1|GH35	0.0	1	987	1	982

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5IFP_A	5.66e-177	19	956	37	979	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]
5IFT_A	1.57e-176	19	956	37	979	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]
1TG7_A	1.26e-173	24	958	2	945	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]
3OG2_A	5.76e-169	24	956	22	975	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]
4IUG_A	4.14e-165	19	967	37	988	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B6H5X9|BGALC_PENRW	0.0	18	986	20	981	Probable beta-galactosidase C OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=lacC PE=3 SV=1
sp|B0Y752|BGALC_ASPFC	0.0	4	987	1	983	Probable beta-galactosidase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=lacC PE=3 SV=1
sp|Q2UMD5|BGALC_ASPOR	0.0	1	987	1	984	Probable beta-galactosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=lacC PE=3 SV=1
sp|A7EZS5|BGALC_SCLS1	0.0	1	987	1	984	Probable beta-galactosidase C OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) OX=665079 GN=lacC PE=3 SV=1
sp|B6QHA9|BGALC_TALMQ	0.0	7	987	6	999	Probable beta-galactosidase C OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) OX=441960 GN=lacC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001595	0.998394	CS pos: 20-21. Pr: 0.5814

TMHMM  Annotations     

There is no transmembrane helices in Bcin04g06020.1:RNA-p1.