CAZyme Information: Bcin03g07850.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin03g07850.1:RNA-p1
• CAZy Family: CE5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
535	bcin_chr_3|CGC12	56086.30	4.4962

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_3:2681140-2682860(+)

Full Sequence      

MHAIGYIPSLSNTLFLFSNIMYQIFAIASIFSLGFLGVCHGQVTGIDVRDMMEEMEHIWV
DNDGTNSNGFVKGVSPCLNYALGSSNQGEQTSAQWVRFAFHDFVTANTTTGTGGMDASLG
FESTRGENHGLFVNDSLTFFKPTVNAYLSMSDNIALAVVASVAKCGGSNSGIKLRVGRID
ATSAGPAGVPGPATDLNTTLAQFAAAGFDASQTIGLTACGHSLGRVHNSDTPNVVNSSFV
TATNLDGGEPFDSTPGVLDPNNINDYLDGTGNRGGPLCTAANVADRSDYRLYISDNNATI
QTMSEETAFQTKCNSLFEKMIEVVPSTVTLSDAVKPMEWKAVDVLMDISLRGDVSISGLI
RNLYTTTQPPKTVSYSTNSSTGNSSTGTSSETSGSGTSIFGSTTYWPFNSTIAPGTTSLS
FNNVTYSVNDNIFVLPAQSSFDSSSGSVIVKSAALTSASGNGVMTAVLYVPTEQEGTISP
KIVQQNVTLTSYGTAGAYTLYSTDTVKISSTGTVIVKVAQGDSSSRTIKVTTFAP

Enzyme Prediction     

No EC number prediction in Bcin03g07850.1:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	84	274	8.2e-22	0.7058823529411765

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173829	plant_peroxidase_like_1	1.86e-73	53	322	6	264	Uncharacterized family of plant peroxidase-like proteins. This is a subgroup of heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX) which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions.
395089	peroxidase	2.17e-15	93	228	17	156	Peroxidase.
173826	ligninase	1.66e-12	140	274	93	215	Ligninase and other manganese-dependent fungal peroxidases. Ligninases and related extracellular fungal peroxidases belong to class II of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class II peroxidases are fungal glycoproteins that have been implicated in the oxidative breakdown of lignin, the main cell wall component of woody plants. They contain four conserved disulphide bridges and two conserved calcium binding sites.
173825	ascorbate_peroxidase	1.17e-05	96	258	34	206	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
173827	secretory_peroxidase	0.001	149	227	95	173	Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA18666.1|AA5_1	3.51e-50	41	502	17	495
QRW22025.1|AA2	4.40e-50	53	361	27	328
UKZ86986.1|AA0	5.46e-49	50	371	29	351
QBZ57066.1|AA0	1.20e-48	52	373	31	345
VBB76056.1|AA0	6.24e-47	53	502	34	498

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BLK_A	1.25e-07	96	259	43	195	CRYSTAL STRUCTURE OF FUNGAL VERSATILE PEROXIDASE I FROM PLEUROTUS OSTREATUS - CRYSTAL FORM I [Pleurotus ostreatus],4BLL_A CRYSTAL STRUCTURE OF FUNGAL VERSATILE PEROXIDASE I FROM PLEUROTUS OSTREATUS - CRYSTAL FORM II [Pleurotus ostreatus],4BLN_A CRYSTAL STRUCTURE OF FUNGAL VERSATILE PEROXIDASE I FROM PLEUROTUS OSTREATUS - CRYSTAL FORM III [Pleurotus ostreatus],4BLX_A CRYSTAL STRUCTURE OF FUNGAL VERSATILE PEROXIDASE I FROM PLEUROTUS OSTREATUS - CRYSTAL FORM IV [Pleurotus ostreatus],4BLY_A Crystal Structure Of Fungal Versatile Peroxidase I From Pleurotus Ostreatus - Crystal Form V [Pleurotus ostreatus],4BLZ_A Crystal Structure Of Fungal Versatile Peroxidase I From Pleurotus Ostreatus - Crystal Form Vi [Pleurotus ostreatus],4BLZ_B Crystal Structure Of Fungal Versatile Peroxidase I From Pleurotus Ostreatus - Crystal Form Vi [Pleurotus ostreatus],4BM0_A Crystal Structure Of Fungal Versatile Peroxidase I From Pleurotus Ostreatus - Crystal Form Vii [Pleurotus ostreatus]
3FMU_A	9.19e-07	96	259	42	194	Chain A, Versatile peroxidase VPL2 [Pleurotus eryngii]
3FM6_A	1.22e-06	96	259	42	194	Chain A, Versatile peroxidase VPL2 [Pleurotus eryngii]
2VKA_A	1.53e-06	96	259	42	194	Site-Directed Mutagenesis of the Catalytic Tryptophan Environment in Pleurotus eryngii Versatile Peroxidase [Pleurotus eryngii]
5FNE_A	1.62e-06	96	259	42	194	Crystal Structure Of Fungal Versatile Peroxidase From Pleurotus Eryngii Triple Mutant E37k, H39r & G330r [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AUF4|WSCD2_ARTBC	2.92e-47	52	374	27	341	WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07870 PE=1 SV=1
sp|Q9UR19|VPL1_PLEER	7.00e-06	96	259	72	224	Versatile peroxidase VPL1 OS=Pleurotus eryngii OX=5323 GN=vpl1 PE=1 SV=1
sp|O94753|VPL2_PLEER	9.29e-06	96	259	72	224	Versatile peroxidase VPL2 OS=Pleurotus eryngii OX=5323 GN=vpl2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.967411	0.032620

TMHMM  Annotations     

Start	End
13	35