CAZyme Information: Bcin03g07360.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin03g07360.1:RNA-p1
• CAZy Family: CE5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
385		39314.15	7.4389

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_3:2487519-2488842(+)

Full Sequence      

MHSLLFWLTAALLPFAHGAGVTGSASGAAHGVTGGGSASPVTPSTTAELISYLTDSSPRV
ILITKTFDFRGTLGTTTATGCVPTSNTCGSSGQNAINANGWCGSAPATTVKYDNAGTTPI
QVKSNKSIVGVGSAGVIIGRGFYLSGVSNIIIQNVHITNLNPSLIWGGDAIQLVGTDLIW
IDHCKFSLIGRQMLVTGYNAAGRLTISNNEFDGQTSWSATCNGQHYWTMLFYGAADYVTL
ANNYIHHCSGRAPKVGGSSGDAITMHAVNNYFYNVAGHDFDIGVGAAVLLEGNYFQSVTT
PITAASSSAGGSIFTTASGTESSCTAYLGRACVANALSSSGAMAGYGTTAFLATIKTKES
GYVPAAIAASSVPAYVVAHAGIGKL

Enzyme Prediction     

EC	4.2.2.10:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	109	296	3.1e-89	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	1.01e-45	109	298	3	189	Amb_all domain.
226384	PelB	2.61e-23	19	385	35	344	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	5.64e-14	118	295	28	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ48538.1|PL1_4	2.91e-273	1	385	1	385
CCD51274.1|PL1_4	2.91e-273	1	385	1	385
QSZ35825.1|PL1_4	1.44e-229	1	385	1	383
APA08244.1|PL1_4	3.35e-202	1	385	1	383
BCR84521.1|PL1_4	1.48e-121	9	385	11	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	2.22e-100	20	385	2	359	Pectin Lyase A [Aspergillus niger]
1QCX_A	6.29e-100	19	384	1	359	Pectin Lyase B [Aspergillus niger]
1IDJ_A	4.05e-98	20	385	2	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1VBL_A	3.01e-09	120	296	128	331	Structure of the thermostable pectate lyase PL 47 [Bacillus sp. TS-47]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8NJK6|PELF_ASPNG	1.75e-119	20	385	23	383	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	1.75e-119	20	385	23	383	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	1.24e-118	1	385	4	382	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|B8N316|PELF_ASPFN	1.24e-118	1	385	4	382	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|Q0CZD4|PELF2_ASPTN	2.26e-118	8	385	9	380	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000262	0.999713	CS pos: 18-19. Pr: 0.9807

TMHMM  Annotations     

There is no transmembrane helices in Bcin03g07360.1:RNA-p1.