CAZyme Information: Bcin03g07100.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin03g07100.1:RNA-p1
• CAZy Family: CE4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
659		76233.05	8.6543

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_3:2415741-2417776(-)

Full Sequence      

MAGQTRRRSSSAAFQQRIEQVHFVPFDGHDETSRPSLSAMIMKTRRKMKSRQFLLLISIL
TLATFSIFYLRAPFPYHSTSFPSSNQKPKQPSIPNRIPTSFDDVKKPQEASYHIGPSHPI
YQLIKDNEQAFENTKAKQSKTLEEAVAEYRKRYGIPPPPNFDKWYNFAKSKGVKLIDEYD
NIHTSLTPFWGLKPETIRGRAREALGFPNNLIGLLIRGGKVTKIEGGNQWQQDATVGMMK
PFLKYLPDMDLCFNIHDEPRVVVPYEDLARLVHVAKDQNMPNANSVEAPRNSWSPRPIDI
TSDGLRVPEVKTTRFNVFSHQPTWTHSRMSCPPDSAARGLNDGLKEDNYGSYAVTELGFV
YNQTAFSDICQSPSFSESFGFFDRPNAFNIVHDLFPIFSQSKISSFSDILYPSPWYWYGK
VPYEEAEDKAWKDKKDKIYWRGSTTGGFSRDGGWRRQHRQKVVQKVNAGDQAKILVNRGE
ETKEDWQVKSVPRSDYKEIFDIFFSHVGQCDPGDCEAQKNFFDVKEAAKQQDAWKYKYLL
DMDGNAFSGRFYAFLKSKSLVYKMAVFREWHEEWLKPWVHYIPLSLRGDEWVESVRWFAG
EDVGRKEAERIALQGRDWADHVLRNEDLEVWFFRLMLEYGRLVDDDREIIGYTGTTGST

Enzyme Prediction     

No EC number prediction in Bcin03g07100.1:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	373	643	3.9e-83	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.56e-20	392	642	28	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.02e-08	396	642	108	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD51306.1|GT90	0.0	1	659	1	659
ATZ48502.1|GT90	0.0	1	659	1	659
APA08219.1|GT90	0.0	1	659	1	659
QSZ35850.1|GT90	0.0	1	656	1	663
VDB84387.1|GT90	4.06e-290	48	652	1	598

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	2.31e-08	396	643	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]
5L0R_A	7.76e-07	383	643	105	342	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	6.29e-59	115	648	149	661	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	1.74e-09	526	643	272	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q29AU6|RUMI_DROPS	9.18e-08	396	643	164	389	O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=rumi PE=3 SV=1
sp|Q8T045|RUMI_DROME	1.22e-07	396	643	166	391	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|Q7ZVE6|PLGT2_DANRE	1.96e-07	532	642	357	465	Protein O-glucosyltransferase 2 OS=Danio rerio OX=7955 GN=poglut2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999913	0.000126

TMHMM  Annotations     

Start	End
53	72