CAZyme Information: Bcin03g05820.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin03g05820.1:RNA-p1
• CAZy Family: CE3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329		34411.14	8.0769

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_3:1951921-1953027(-)

Full Sequence      

MKFSIVSAGLLAAFASAAPTPTSDEIVNRAAIAKRATVTDACNIGYASTNGGTKGGAGGA
TTTVSTYAQFTKAATAGNTVVVVSGPITQAASQVKVASDTTIIGKNSKVVLTGFGLLVKG
QSNVIIRNLAIKEVLAANGDALGIQKSTNVWVDHVDLSSNRDHDKDYYDGLFDVTHAADY
VTLSNSYIHDHWKASLIGHSDSNSAEDTGHLRVTYANNYWKNINSRGPSIRFGTAHFYNS
YHDTVADGINTRDGAQVLVESNAWTGSKKPLYSTDSGYAVANDNDFGSGSNEAEKGTMSA
SKLGYKYTLLGSSKVKAAVVGTAGVTLSF

Enzyme Prediction     

EC	4.2.2.2:30

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	82	264	6.2e-88	0.994475138121547

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	2.75e-62	87	263	5	185	Amb_all domain.
226384	PelB	7.52e-51	64	326	59	342	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	1.31e-39	90	262	26	209	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ48357.1|PL1_7	1.62e-228	1	329	1	329
CCD51516.1|PL1_7	3.82e-227	1	329	1	329
APA08100.1|PL1_7	1.36e-204	1	329	1	329
QQK40310.1|PL1_7	5.10e-138	9	329	13	324
AFV30217.1|PL1_7	5.10e-138	9	329	13	324

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1PCL_A	1.04e-35	39	265	4	277	Chain A, PECTATE LYASE E [Dickeya chrysanthemi]
3VMV_A	6.13e-34	45	262	6	244	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
1JRG_A	1.49e-26	44	265	15	288	Chain A, Pectate lyase [Dickeya chrysanthemi],1JRG_B Chain B, Pectate lyase [Dickeya chrysanthemi],1JTA_A Chain A, pectate lyase A [Dickeya chrysanthemi]
1OOC_A	2.06e-26	44	265	15	288	Chain A, Pectate lyase A [Dickeya chrysanthemi],1OOC_B Chain B, Pectate lyase A [Dickeya chrysanthemi],1PE9_A Chain A, Pectate lyase A [Dickeya chrysanthemi],1PE9_B Chain B, Pectate lyase A [Dickeya chrysanthemi]
3ZSC_A	1.99e-25	52	242	20	213	Catalytic function and substrate recognition of the pectate lyase from Thermotoga maritima [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0XT32|PLYA_ASPFC	1.69e-133	1	329	1	321	Probable pectate lyase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyA PE=3 SV=1
sp|Q4WIT0|PLYA_ASPFU	9.72e-133	1	329	1	321	Probable pectate lyase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyA PE=3 SV=1
sp|A2QV36|PLYA_ASPNC	1.48e-132	2	329	5	323	Probable pectate lyase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=plyA PE=3 SV=1
sp|Q9C2Z0|PLYA_ASPNG	5.98e-132	2	329	5	323	Pectate lyase A OS=Aspergillus niger OX=5061 GN=plyA PE=1 SV=1
sp|A1CYB8|PLYA_NEOFI	1.59e-131	1	329	1	321	Probable pectate lyase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000331	0.999623	CS pos: 17-18. Pr: 0.9605

TMHMM  Annotations     

There is no transmembrane helices in Bcin03g05820.1:RNA-p1.