CAZyme Information: Bcin03g04220.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin03g04220.1:RNA-p1
• CAZy Family: CE16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326	bcin_chr_3|CGC16	37794.55	8.3966

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_3:1408566-1409605(-)

Full Sequence      

MRRGTLLFLVINFIVIGFLVNAFSTLISLLFIDGAADAIHRSEIPAPGSEMIENRTQLIP
KIIHQTYINESIPERWKAGQQSCIELHDDYEYKLWTDEASRAFIATEYPWFLDTFDSYPF
PIQRADSIRYFVLAHYGGIYIDLDDGCKRRLDPLLSYPAWLRRTIPTGISNDAMGSVPQH
PFFLRVIESLQAYNRNWGMPYITVMYSTGPLFLSVLWIEYMRTVTDEAGRVRNLMPDEYN
KHAWSFFNIVKGNSWHGKDAQTIFWMGKHWLLLTVAGFAIAGVVGGFLWLAWNMWVVRSG
KSQRRGMALWRRVSGKDRYELLDRSV

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	74	155	6.5e-23	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.50e-80	41	293	63	318	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.58e-27	73	157	1	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD51739.1|GT32	3.94e-248	1	326	1	326
ATZ48182.1|GT32	3.94e-248	1	326	1	326
APA07946.1|GT32	1.25e-235	1	324	1	324
QSZ30681.1|GT32	2.55e-219	1	326	1	326
BCS17906.1|GT32	9.49e-162	1	305	1	305

PDB Hits     

Bcin03g04220.1:RNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	1.36e-102	1	292	1	298	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	3.03e-100	26	292	26	290	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	3.48e-90	29	288	29	287	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	9.04e-88	58	280	81	306	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	2.14e-55	59	269	64	275	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.683551	0.316455

TMHMM  Annotations     

Start	End
10	32
196	218
270	292