CAZyme Information: Bcin03g03830.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin03g03830.1:RNA-p1
• CAZy Family: CE16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348	bcin_chr_3|CGC6	37988.87	4.1311

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_3:1287596-1288715(+)

Full Sequence      

MRSFALLSLTASLLGSVSASPALVNRAVAFNRTVAPAGAIVVDETCEIAGSYTTFQEGID
ALSTTTTDAQYIFVAPGTYFEQVYLPPLASNLTIQGYTTDARTYENNEATLTYNLALINT
TSDDLTATFRAHNTNTKVYNLIIENTFGHINSNGQNLALSSYASNVGYYATQFWGYQDTV
LAEAGYQLYAKCLIVGAIDFIFGEKALAWFENNDIRTIANGAITASGRTSAAVDSWYVIN
NSNIANLNSSLTPYNNYLGRPWRDYARVVFQNSYLGDNIKAAGWQEWSTSTPNTDGVTFG
EYNNYGPGSVLEEGPRANFSSQFTAPVDITTVLGTSYTSEFYYDASYM

Enzyme Prediction     

EC	3.1.1.11:3	3.2.1.15:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	49	312	6e-68	0.8819444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	3.93e-42	50	311	10	268	Pectinesterase.
178051	PLN02432	7.24e-40	35	325	8	274	putative pectinesterase
178372	PLN02773	4.81e-35	49	309	14	270	pectinesterase
178606	PLN03043	8.72e-33	15	309	212	492	Probable pectinesterase/pectinesterase inhibitor; Provisional
215179	PLN02314	3.02e-31	31	313	279	544	pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD51798.1|CE8	6.57e-249	1	348	1	348
CAD21438.1|CE8|3.1.1.11	6.57e-249	1	348	1	348
ATZ48137.1|CE8	6.57e-249	1	348	1	348
APA07916.1|CE8	1.42e-193	1	348	1	349
APA11010.1|CE8	1.45e-161	6	348	7	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	5.30e-58	31	337	2	291	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	2.95e-57	31	337	2	291	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1XG2_A	2.61e-20	50	309	13	269	Chain A, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	1.76e-19	49	309	16	273	Pectin methylesterase from Carrot [Daucus carota]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	6.79e-90	16	348	4	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	2.48e-87	16	347	4	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|A2QK82|PMEA_ASPNC	4.22e-57	31	337	30	319	Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pmeA PE=3 SV=1
sp|B8NPS7|PMEA_ASPFN	5.61e-53	32	347	28	324	Probable pectinesterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pmeA PE=3 SV=1
sp|Q2UBD9|PMEA_ASPOR	7.89e-53	32	337	28	316	Probable pectinesterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000290	0.999652	CS pos: 26-27. Pr: 0.8000

TMHMM  Annotations     

There is no transmembrane helices in Bcin03g03830.1:RNA-p1.