CAZyme Information: Bcin03g01880.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin03g01880.1:RNA-p1
• CAZy Family: CBM63
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
529	bcin_chr_3|CGC14	59991.32	7.8687

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_3:628482-630304(-)

Full Sequence      

MPFFGRAYLFLLLLRVWFALSPSYLHPDENFQGPEVIAGQIFSYPVKLTWEFTSENPIRS
VFPLWPIYGLPMLLLRWLWIGNGNDGEIPPIAVFFALRLLMLTLSFVLGDWAIWELAESK
RHYKIAVLLVASSYVTWTYQTHTFSNSIETLAVAWSLILIQKITAVKKHTSVSLCGILAF
VVVFGIFNRITFPAFLFIPGLRLLPHFKRKPFSLVAMILFGLLATFIAISLDTNFYAKVP
VTWSYLFSHPTITPFNNLNYNLAPENLALHGLHPWYQHSLINLPQLLGPATILLFLRPVA
PLRLCSAISGVVVLSFFKHQEARFLLPAIPLILSSVRLPKSGISLRIWVGLWISFNVLLG
LLMGVYHQGGVVPTQVFLSKQLDATHAFWWKTYSPPIWLLNGKNEVLDTHDLMGIRGELM
IEEISKLATCLPKSGEELTEATYLIAPTSATFLDKYTANQTDLYFEEIFTYKQHLNLDDM
DFGDDGFWSTITRVVERRGIAAWRVTMNCPGGTKDMNEPGVISENRESS

Enzyme Prediction     

EC	2.4.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	8	399	1.7e-79	0.987146529562982

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
281842	Glyco_transf_22	1.67e-50	7	398	2	410	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.
215437	PLN02816	1.30e-06	6	381	40	426	mannosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ47912.1|GT22	0.0	1	529	1	529
CCD44011.1|GT22	0.0	1	529	1	529
APA07854.1|GT22	0.0	1	529	1	528
QSZ35572.1|GT22	0.0	1	529	1	530
QPH02021.1|GT22	2.18e-252	6	510	4	516

PDB Hits     

Bcin03g01880.1:RNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I785|SMP3_GIBZE	3.10e-245	6	510	4	516	GPI mannosyltransferase 4 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=SMP3 PE=3 SV=2
sp|Q2UTP0|SMP3_ASPOR	1.23e-182	6	504	4	536	GPI mannosyltransferase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=smp3 PE=3 SV=1
sp|Q4WTT7|SMP3_ASPFU	1.71e-178	6	503	4	539	GPI mannosyltransferase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=smp3 PE=3 SV=2
sp|Q5BAX7|SMP3_EMENI	4.73e-165	6	503	4	534	GPI mannosyltransferase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=smp3 PE=3 SV=2
sp|Q6CDD0|SMP3_YARLI	9.99e-89	12	481	13	495	GPI mannosyltransferase 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=SMP3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000327	0.999633	CS pos: 19-20. Pr: 0.9554

TMHMM  Annotations     

Start	End
61	80
95	117
170	192
212	231
347	369