CAZyme Information: Bcin03g01540.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin03g01540.1:RNA-p1
• CAZy Family: CBM48
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
628	bcin_chr_3|CGC15	66882.12	4.3695

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_3:514966-516966(+)

Full Sequence      

MFSKDFTAVGLAALSLVSQSQAGPTLSTSHLKARALLGNSFGVPGRNATYDYVVVGGGNA
GLTIAMRLAEAEAGSVAVIEAGTFYEISNGNISQVPATDGVFAGKGATDWQPQIDWGYQT
TPQSGAHNTSLHYARGKTLGGCSARNFMVYQRGTVGSMQKWADQVGDDSYEWDNFLPFYQ
KSVNFTSPDMTLRSANSTPSFVAADAASFPATGPLSVTWSHYAQAFGTWAIEGLSQIGMP
VIPGFLGGNLIGTSYPTFTLDAEKMTRESSETSFLRVGMTSPDLKVYTLSMAKKILFDES
KKATGVLVETGGYPFTLSATKEVILSAGVFGSPQLLMASGVGPADELSAVGIDVIADLPG
VGKGMQDHLFTGVGYRVNAPTISRLVNDPVYAAEQLEMYESTPAAGMYSSPDTDVLGWEK
IPEKYRSQWSNETQKALAEYPADWPEVEYIAISSFLGNQVIEGTDPNDGFNYATLAIALV
APRSRGSLTITSADTNVAPLIDPGFLTEQSDVDIMVAAVKRVREFYATDALQSFVIGDEY
FPGSNISTDAQIEDFVRTSFNTIWHATSTCSMGPINDTNTVVDTQARVLGVSGVRVVDAA
AFPLLPPGHPMSTVYAFAEKIACDIIGC

Enzyme Prediction     

No EC number prediction in Bcin03g01540.1:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	49	626	1.4e-178	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.63e-94	49	626	5	531	choline dehydrogenase; Validated
225186	BetA	7.53e-87	46	622	4	530	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	9.44e-40	482	621	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	3.57e-30	1	614	1	565	Protein HOTHEAD
366272	GMC_oxred_N	1.31e-20	134	369	22	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ47873.1|AA3_2	0.0	1	628	1	628
APA07712.1|AA3_2	0.0	1	628	1	628
QSZ35459.1|AA3_2	0.0	1	627	1	627
QGA12464.1|AA3_2	3.85e-288	1	627	1	611
AUS76865.1|AA3_2	1.72e-205	3	626	2	611

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	7.18e-63	50	626	2	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.41e-62	48	626	1	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	9.86e-59	50	619	41	591	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6ZE2_A	1.16e-57	47	626	3	582	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
3NNE_A	1.15e-55	50	626	14	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CFL2|PATE_ASPCL	5.01e-234	11	627	17	626	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	3.79e-231	8	627	11	626	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|A0A1U8QYA8|CICC_EMENI	1.77e-178	20	626	13	608	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	1.08e-157	47	626	38	607	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q0CJ60|ATC_ASPTN	5.52e-148	36	626	32	594	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.007086	0.992872	CS pos: 22-23. Pr: 0.9567

TMHMM  Annotations     

There is no transmembrane helices in Bcin03g01540.1:RNA-p1.