CAZyme Information: Bcin03g00950.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin03g00950.1:RNA-p1
• CAZy Family: CBM24
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1150		126966.96	7.0073

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_3:332394-335846(-)

Full Sequence      

MVSFNELKKALVADITTDMSSLNEPLSDSQYNCGFDILLNGSEWNLYEEFIIPQLSQQVA
SLLATRSTLSVLEIGPGSKSVLGYMPLYLRRKIRRYAAFEPNIISATGLEDWISSCPESN
SLFPCLETTPHIYRAPFVLEDEGEKNIIETNASHDEQTFDLILFCHSMYGMKQKERFARK
AVEMLVPNPESGRVVIFHRDQSLELDGLASYSTTVFPTGTVSLPDKNEALDAFAPFVVGY
IKKDVEADMALRIKWRETCRALACHDEKITGCLFFSSPQRMVSLTRHANALVELVLQVPL
AKEGRIVKSWEARLHRPTSICRPTTVEHVRKCVQWALKHKLKLTVIGGGHSAHCLWPNVV
SIDLEAFNRVHVITSSDNANTRPASNSLIVAEAGCKVGDIIQEAMKFGLTVPLGSRPSVG
AGLWLQGGFGHLSRLYGLACDNIVGAVIVSVTSGQIYHVGEVPAQNLPAGAIRPENENDL
LWAIKGAGTNFGIVISVTFKTYSAPTYFVRNWIFPVGEGTEVRLKLGDVNSIARNLPRSC
SIDAFLYSDKNQLHLGVTMFQASINKNFEMPSLVNDILGPVKQCKEVDGVGLFETEMYMS
TMHGGHSGKTSSFKRCLFLDNIDDVQIVDILREAIKNCPTPFCYLHLLQCGGATRDNTTE
ASAFGCRDWEFACVITGVWPRNRTETEPVRTTIQWVYDIVKRLLPFCSGVYSADLGPDPR
DNALAAKAFGANMSRLAQLKHTMDPYNVIAYACPLFETPTKQKLIILVTGDSAAGKDFCA
EIWVTIIIGCASRMLTARSVSISDATKREYATETGADINRLLSDRSYKEEHRPALTKFYE
KQVINHPQAPMEHFQSVVRDSGSFDVLFVTGMRDEAPLTTFSHLVPDSKVLDVRVNASQV
VLRAHNIGCYEETKVSLDGPNLSTLPYLPSLVFNNQTLGSEAAKTFAKKYFLPLLHEDFT
RLANMVRAVPNHPRQSVTFRHVLGICQNPGGLTLCTDLLQRHFIGEWAKVDTLVCCESGG
FLFASPLGAQTGIPLALVRRSGKLPPPTISVEKSPSHISYAESGDSQQNMFEMDLGLICK
SNSILVVDDVLATGRTLCAVLKLMMKAGVQPKNIRVMVVAEFPTHSGRELLRQEGFGEVG
IQSLLVFGGK

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	315	522	1.5e-46	0.4104803493449782

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235028	PRK02304	7.76e-29	962	1149	6	175	adenine phosphoribosyltransferase; Provisional
223577	Apt	3.34e-23	961	1136	7	169	Adenine/guanine phosphoribosyltransferase or related PRPP-binding protein [Nucleotide transport and metabolism].
398111	P-mevalo_kinase	4.11e-23	768	886	1	111	Phosphomevalonate kinase. Phosphomevalonate kinase (EC:2.7.4.2) catalyzes the phosphorylation of 5-phosphomevalonate into 5-diphosphomevalonate, an essential step in isoprenoid biosynthesis via the mevalonate pathway. This family represents the animal type of the enzyme. The other is the ERG8 type, found in plants and fungi, and some bacteria (see pfam00288).
223354	GlcD	8.22e-23	296	526	9	228	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	1.51e-22	317	460	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI68899.1|AA7	2.89e-18	315	505	60	233
CCT73375.1|AA7	2.89e-18	315	505	60	233
QGI99788.1|AA7	2.89e-18	315	505	60	233
QGI86269.1|AA7	2.89e-18	315	505	60	233
QRC92907.1|AA7	3.65e-17	297	505	37	233

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BVF_A	9.59e-25	291	513	1	214	Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 3 (P1) [Paenarthrobacter nicotinovorans],2BVF_B Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 3 (P1) [Paenarthrobacter nicotinovorans],2BVG_A Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 1 (P21) [Paenarthrobacter nicotinovorans],2BVG_B Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 1 (P21) [Paenarthrobacter nicotinovorans],2BVG_C Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 1 (P21) [Paenarthrobacter nicotinovorans],2BVG_D Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 1 (P21) [Paenarthrobacter nicotinovorans],2BVH_A Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 2 (P21) [Paenarthrobacter nicotinovorans],2BVH_B Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 2 (P21) [Paenarthrobacter nicotinovorans],2BVH_C Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 2 (P21) [Paenarthrobacter nicotinovorans],2BVH_D Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 2 (P21) [Paenarthrobacter nicotinovorans]
6FYD_A	4.46e-20	316	748	44	452	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]
6FYG_A	5.95e-20	316	748	44	452	The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_B The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_C The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_D The crystal structure of EncM V135T mutant [Streptomyces maritimus]
6FYE_A	7.92e-20	316	748	44	452	The crystal structure of EncM H138T mutant [Streptomyces maritimus],6FYE_B The crystal structure of EncM H138T mutant [Streptomyces maritimus]
6FYF_A	1.06e-19	316	748	44	452	The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_B The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_C The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_D The crystal structure of EncM V135M mutant [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54H55|Y8969_DICDI	1.21e-32	308	747	38	439	FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0289697 PE=2 SV=1
sp|P08159|HDNO_PAENI	8.73e-24	296	513	5	213	(R)-6-hydroxynicotine oxidase OS=Paenarthrobacter nicotinovorans OX=29320 GN=6-hdno PE=1 SV=2
sp|Q65U83|APT_MANSM	1.74e-18	955	1135	1	168	Adenine phosphoribosyltransferase OS=Mannheimia succiniciproducens (strain MBEL55E) OX=221988 GN=apt PE=3 SV=2
sp|G3XMD0|AZAL_ASPNA	1.81e-18	322	552	66	274	FAD-linked oxidoreductase azaL OS=Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7) OX=380704 GN=azaL PE=2 SV=2
sp|A6VMZ1|APT_ACTSZ	2.37e-18	955	1135	1	168	Adenine phosphoribosyltransferase OS=Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z) OX=339671 GN=apt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in Bcin03g00950.1:RNA-p1.