CAZyme Information: Bcin02g06910.2:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin02g06910.2:RNA-p1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
468		47860.97	4.0262

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_2:2438660-2440119(-)

Full Sequence      

MKSAILSLAGFSLVQLTLAQPFNRHNAHRAVHDKRNLVTVIDTVVIQATEIPEVIIYVST
DGTPLSTTTEYIDNEPTTVYESNPSVATSSAATTSTPDVDVQAAAAVAVQPSTPTTAAAA
STTPVQAPSVEVSVAASVAVSVAYTSAAAPVATTSSSAAAPVVSSSSSSAVVSVPVASSS
STTSSAAAASTSAVASSSGGYGFAYSPYMANNACKTQDQVNEDFAAIPSSYSTVRIYGTD
CNQVATTLVAAKKYGFTIFAGVYDFAEVSSETQAIVDAVDGDWSLITTISIGNEWVNNGV
TDAAGVASAVATAKSILSAANYPGKVVAVDTLAATKLYPSLCDNVDYCAVNCHPFFDTNT
AADAAGTFLSTQISELRALLSNPDMDIVITETGWPSAGTSHDQAVASPAAQTTAMAAIKD
LFASNASNVFLFSTFNDYWKVNTAALYMAEQSWGYLGNSPSDVAAGLV

Enzyme Prediction     

No EC number prediction in Bcin02g06910.2:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	209	454	4.7e-22	0.9292604501607717

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	9.42e-58	202	460	47	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	8.00e-04	380	454	222	295	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ47406.1|GH17	8.04e-253	1	468	1	468
ATZ47405.1|GH17	8.04e-253	1	468	1	468
APA14200.1|GH17	7.93e-195	1	468	1	473
QSZ31209.1|GH17	3.89e-135	1	468	1	339
CCD34552.1|GH17	8.06e-75	350	468	7	125

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.70e-12	201	407	38	239	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	9.97e-12	201	407	38	239	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q04951|SCW10_YEAST	1.24e-49	199	458	135	388	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|P53334|SCW4_YEAST	6.31e-48	202	458	135	385	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|Q59XX2|MP65_CANAL	1.42e-47	199	458	125	378	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|Q2US39|BTGE_ASPOR	3.91e-37	202	454	348	596	Probable beta-glucosidase btgE OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=btgE PE=3 SV=1
sp|B8MXP5|BTGE_ASPFN	3.91e-37	202	454	348	596	Probable beta-glucosidase btgE OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=btgE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000257	0.999693	CS pos: 19-20. Pr: 0.9844

TMHMM  Annotations     

There is no transmembrane helices in Bcin02g06910.2:RNA-p1.