CAZyme Information: Bcin02g05270.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin02g05270.1:RNA-p1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1491		166248.71	5.0972

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_2:1880108-1884690(+)

Full Sequence      

MGGFTLPWGLSGALLASTYLHSICATASPAINVGLQTSFPSAPYLIELLETAATENVSSY
FPLLDRIADGYFAKASTDKDLYDNFIKVLTEDGHMDAEALSSYKLALSMRVAAPRIEAQF
QYYHTAAEASIKTEQSSSCPTWVLFDGHQYCSPTLDEPHGTVTGNSQTQELPFDYVLGNP
TGPHSILYADITSPTFGLFHKTLVKTAREGKTSYRLRHRRAIDAGSNKPLMIPGYGVELA
LKRTDYIVIDDRKDDDEGTTKSKTEAKVKFEDEEVADLKPLSTSELSSLGLKASSFIMQS
ERPFDSLIKLSQDFPKHSSAIASHNVSSDFFAEHNYNRGKLVPAGVNVWWMNGVQMIDRQ
IDAIAILDILRKERRLINGVRDLGLTGPEAVQLLSHSSISEAKSDGDVQRFDWRDEIEGG
SVIMWLNDIEKDKRYQEFPETLGALLQRTYPGQLPSVRKEIFNLVIPVDFSAIEDVALVA
ETLASFVKRKLVLHIGLVPITTSPAAVEQTRVLYHLLDVYGLSGAIAYLEASVMNGVAGP
TEKSFQAATEGREVRAEKIAIPLVDLLKSDHYNDRIDAASRWTTRLSADGEFPPIFVDGV
ALSRDENWLQAMVQRLTADLQVIQQGVFNNLFTQESYIPDFFLSEATPRRNSLIVPESDK
NLKIIDITTLSKQHGDVLSKLPKIGSDSASPKEDWAHMILVADLSSASGLELLFSAVKFR
ESVPALEITILHNSPGEMKTSDFSTHLFSHVQKKSDKPLVDAQVLPSLVSPEGPELDLTT
QDSARTYWKEAGPLVRAAGLSPGENVILLNGRLVGPIPAGSKLNQEDFEQLISYERAKRI
TPVYAAMQSLGLSDKIADPLAGAKISSMVALSSVSDTPDGIFEQAPTNRISAFDVWNSSY
TSIETGDSSTATIHMTVTIDPASEQGQKWVPIVKAISELEGVYLKMFLNPKERLQELPVK
RFYRYVLESKPNFDDEGALIEPGASFTGVPQEALLTVKLDIPPAWLVAPKVSIHDPDNIK
LSSIKADVDALYELEHILIEGHSRDMPSGSPPRGAQLILGTERDPHFADTIIMSNLGYFQ
FKANPGFYKIDLQSGRSSEIFKIDSIGSKGWAPGPGDDTSEVVLMSFQGATLYPRLSRKP
GMEGEDVLEAKVESAMDYVSRGLNFAQGILGSKTKAAAAVEEQAEINIFSVASGHLYERM
LNIMMVSVMKNTKHTVKFWFIEQFLSPSFKDFIPHLAAEYGFKYEMVTYKWPHWLRGQTE
KQREIWGYKILFLDVLFPLSLDKVIFVDADQIVRTDMIELVNHDLQGAPYGFTPMCDSRT
EMEGFRFWKQGYWEKFLRGLPYHISALYVVDLRRFRQIAAGDRLRQQYQSLSADPNSLSN
LDQDLPNHMQQVLPIHSLPQEWLWCETWCSDESLKEARTIDLCNNPLTKEPKLDRARRQV
PEWTLYDDEITAVDKKRKGINGDRNESAEGRNTKSRTLEEIVDTKTKKDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1186	1433	6.5e-135	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133054	GT8_HUGT1_C_like	0.0	1186	1433	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
408203	Glyco_transf_24	0.0	1186	1453	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
408201	Thioredoxin_14	1.00e-93	411	654	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
399437	UDP-g_GGTase	8.79e-66	1040	1149	1	109	UDP-glucose:Glycoprotein Glucosyltransferase. UDP-g_GGTase is an important, central component of the QC system in the ER for checking that glycoproteins are folded correctly. This QC prevents incorrectly folded glycoproteins from leaving the ER.
408202	Thioredoxin_15	3.03e-64	666	870	1	204	Thioredoxin-like domain. This is the fourth TRXL(thioredoxin-like) domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ47226.1|GT24	0.0	1	1491	1	1491
CCD34486.1|GT24	0.0	1	1491	1	1491
APA14047.1|GT24	0.0	1	1491	1	1493
QSZ31337.1|GT24	0.0	1	1491	1	1492
UQC87132.1|GT24	0.0	6	1460	67	1499

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	0.0	27	1453	7	1447	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	0.0	27	1453	7	1447	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5Y7O_A	0.0	30	1149	5	1124	Crystal structure of folding sensor region of UGGT from Thermomyces dupontii [Thermomyces dupontii],5Y7O_B Crystal structure of folding sensor region of UGGT from Thermomyces dupontii [Thermomyces dupontii]
6TRT_A	0.0	27	1453	7	1447	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	0.0	27	1453	7	1213	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	9.42e-287	6	1453	1	1424	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	1.50e-232	14	1450	30	1520	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q09332|UGGG_DROME	5.11e-231	25	1453	24	1507	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
sp|Q9JLA3|UGGG1_RAT	4.15e-230	15	1450	31	1520	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q6P5E4|UGGG1_MOUSE	5.81e-230	15	1450	31	1520	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.560264	0.439716

TMHMM  Annotations     

There is no transmembrane helices in Bcin02g05270.1:RNA-p1.