CAZyme Information: Bcin02g01070.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin02g01070.1:RNA-p1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
965		109022.64	5.6288

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_2:461330-464280(+)

Full Sequence      

MKSPLNLSSQWTGYLVLLSTFGSLITPAISVKHENFKTCDQSGFCKRNRAYADQATAVGD
NWSLQAPYRLASETLTWKDGQLQGTILKKLNGGESVRLPITISFLESGSARVTIDEEKRQ
TGEIELRHGSKARKERYNEAANWAIVGGLTLSKDAEYKKYPGVSHITFGPDGKFKAEVTH
APFAIDFKRDDEIQIKFNERGLMNMEHWRPKIEKPEKKEGEEESTEVKTGEDESTWWDES
FGGNTDSKPKGPESVSLDITFPGYEHVFGIPEHAGPLSLKQTRGGEGNHKDPYRLYNADV
FEYIMDSEMTLYGAIPFMQAHRAASTVGVFWLNAAETWIDIIKEKASMNPLSGKTDTKTH
WFSESGLIDVFVFLGPTPKDVTKAYGELTGFTQLPQEFAIAYHQCRWNYVTDEDVKDVDR
KFDKFQIPYDVIWLDIEYTDGKKYFTWDPHTFGNHVDMLSHLDKSDRKLVAIIDPHIKNE
ANYKVVDELKSKDLAVHNKEGSIYEGWCWPGSSHWVDAFNPAAITWWKSLFKTAAFDTPN
LFLWNDMNEPSVFNGPETTMPKDNLHFGNWEHRDVHNVNGLTFVNATYEAMVERKKGELR
RPFILTRSFYAGSQRMGAMWTGDNQASWDHLAAAFPMILNNGIAGFPFAGADVGGFFGNP
EKDLLTRWYQAGAFYPFFRGHAHIDTRRREPYLIGDPYTDIITQALRLRYSLLPAWYTAF
HEASTDGTPIIRPHYFEYPEDESGFAIDDQFFVGSTGLLAKPVVTEGADSVDIYIPDSEV
YYDYFDYTIYTGAGKTTIAAPLEKIPLLMQGGHIIPRKDRPRRSSGLMRWDPYTLVLVLN
KEGKATGELYVDDGETFDYQSGAYIHRSFSFENGVLSSKNIGTKGKLTDKYLKSMKNVGV
EKILVVGAPKEWSELKSVKVGSTTAEITYQAGEGSKAAWALVRAPKVVIGEDWEVEFVEG
GKTEL

Enzyme Prediction     

EC	3.2.1.20:27	3.2.1.84:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	371	815	1.1e-152	0.9953161592505855

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224418	YicI	0.0	162	891	73	744	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
395838	Glyco_hydro_31	0.0	371	815	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269889	GH31_GANC_GANAB_alpha	0.0	390	856	1	467	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
269890	GH31_glucosidase_II_MalA	1.02e-140	390	727	1	339	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
215408	PLN02763	1.57e-110	376	865	164	644	hydrolase, hydrolyzing O-glycosyl compounds

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD48419.1|GH31	0.0	1	965	1	965
ATZ46736.1|GH31	0.0	1	965	1	965
APA05923.1|GH31	0.0	1	965	1	965
QSZ34154.1|GH31	0.0	1	965	1	966
KAF2754890.1|GH31	0.0	4	964	3	990

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DKX_A	0.0	31	957	5	950	Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5DKY_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5JQP_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495]
5DKZ_A	0.0	31	957	5	950	Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5DL0_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495]
5IEF_A	2.21e-258	31	955	1	909	Murine endoplasmic reticulum alpha-glucosidase II with N-butyl-1-deoxynojirimycin [Mus musculus]
5IEG_A	2.28e-258	31	955	1	909	Murine endoplasmic reticulum alpha-glucosidase II with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]
7KRY_A	6.14e-258	15	955	13	940	Chain A, Neutral alpha-glucosidase AB [Mus musculus],7KRY_C Chain C, Neutral alpha-glucosidase AB [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9US55|GLU2A_SCHPO	8.06e-296	16	920	15	894	Glucosidase 2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gls2 PE=1 SV=1
sp|Q8BHN3|GANAB_MOUSE	1.38e-258	16	955	18	941	Neutral alpha-glucosidase AB OS=Mus musculus OX=10090 GN=Ganab PE=1 SV=1
sp|P79403|GANAB_PIG	1.27e-253	10	955	14	941	Neutral alpha-glucosidase AB OS=Sus scrofa OX=9823 GN=GANAB PE=1 SV=1
sp|Q94502|GANAB_DICDI	2.22e-251	15	956	7	941	Neutral alpha-glucosidase AB OS=Dictyostelium discoideum OX=44689 GN=modA PE=3 SV=1
sp|Q14697|GANAB_HUMAN	9.16e-251	16	955	18	941	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001021	0.998955	CS pos: 30-31. Pr: 0.9619

TMHMM  Annotations     

There is no transmembrane helices in Bcin02g01070.1:RNA-p1.