CAZyme Information: Bcin02g00050.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin02g00050.1:RNA-p1
• CAZy Family: AA5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479	bcin_chr_2|CGC8	54609.41	6.5474

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_2:126299-127967(+)

Full Sequence      

MLYPKELSQYATVHVDTRNELRIPSTTEENIAEEVTYPTYYQIDGISPAVLAKLFSVSAE
AKIWGVAAKSLNQANPPRYYPEYTKPGGSNYVYRDFRFWTSGFFPGCLYLLLERRKKCPS
QYDLYEQSLHISQLDFACNWWTLNLHRNATLEETHDLGFMIMPWARPAWELNRDTRALET
LKTSAKTLLNRFSGAVGAIRSWDTCQTRRYNYQDPNTDFLMIIDNMMNLNLLFYVAQETN
DNSMRDAAIQHARTTARTHVRSDSSTTHLVNFDPATGIVKERLTNQGFSHNSCWARGQAW
AIAGFAETFHWTQDYSFLLTSRRCADYFLARLPESGIAPWDFDAHAQLSAIQKQPPDTSA
TLVAAYGMLLIHQALTARGDHSHYLSAALRMVEAVCSQHSNLPAKYTVEGEFQFDTVENG
HVKEPAKIGVDMGHADTIVNGATINNYEFAPRRWADHGLVYADYYFLLFGNELLKMNST

Enzyme Prediction     

No EC number prediction in Bcin02g00050.1:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	95	467	4.2e-92	0.9665653495440729

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400034	Glyco_hydro_88	4.72e-16	99	476	29	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ46610.1|GH88	0.0	1	479	1	479
CCD48264.1|GH88	0.0	1	479	1	471
QKD56650.1|GH88	1.01e-173	54	478	56	488
QYT03137.1|GH88	3.16e-173	49	479	65	498
QGI97417.1|GH88	1.29e-171	51	478	53	487

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2ZZR_A	7.62e-42	82	401	49	348	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	7.78e-42	82	401	50	349	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3ANI_A	3.98e-41	82	401	50	349	Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]
3VXD_A	3.98e-41	82	401	50	349	Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_B Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_C Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_D Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316]
3WUX_A	3.98e-41	82	401	50	349	Crystal structure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KLZ3|PLH1_FORAG	1.56e-41	99	479	77	396	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
sp|Q8E372|UCDH_STRA3	4.00e-41	82	401	50	349	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
sp|Q9A0T3|UCDH_STRP1	5.09e-37	89	405	60	354	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
sp|Q8DR77|UCDH_STRR6	3.01e-34	99	401	67	347	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
sp|Q9RC92|UGL_BACGL	1.46e-33	87	395	30	317	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000000

TMHMM  Annotations     

There is no transmembrane helices in Bcin02g00050.1:RNA-p1.