CAZyme Information: Bcin01g11220.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin01g11220.1:RNA-p1
• CAZy Family: AA4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
294		31929.17	4.3077

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_1:3936108-3936992(-)

Full Sequence      

MKSTSIALALASTLTGANAYWKGFNAQATLGNGACKSQADWENDFRLIQSFPGGFDSLRV
YASSDCNTIANVAPAAIATGGKVLLGVWTEDAAHYDAEKQALLHAVQTYGFNWVVAVSVG
SEDLYRGDTTASTLAQQIYDVRGMLSTVNGYSSAVQVGHVDTWTMWTDGRNTDVIKACDF
IGLDGYPYFQNTQDNDISQGYDLFWQSVNAVRSTVQNAQSGAWVWVTESGWPTAGAQENK
AVASVDNARTYWKQVACEAFNQGHTFWYSLQDFDAIPSFGVVDGNGNLKYDLSC

Enzyme Prediction     

No EC number prediction in Bcin01g11220.1:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	55	294	6.3e-22	0.9131832797427653

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	4.37e-49	22	285	46	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	2.49e-23	33	294	14	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD34315.1|GH17	9.39e-224	1	294	1	294
ATZ46547.1|GH17	9.39e-224	1	294	1	294
APA06410.1|GH17	2.52e-185	1	294	1	295
QSZ35382.1|GH17	7.81e-173	1	294	1	295
VDB89901.1|GH17	1.50e-137	8	294	7	293

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	8.74e-22	34	289	48	289	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	6.06e-21	34	289	48	289	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UUZ1|EGLC_ASPOR	6.58e-64	8	294	7	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglC PE=3 SV=1
sp|Q4WG16|EGLC_ASPFU	3.40e-63	8	294	7	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	3.75e-63	8	294	7	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|A1DJ47|EGLC_NEOFI	1.60e-61	8	294	7	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1
sp|A1CD22|EGLC_ASPCL	4.02e-59	8	294	7	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000311	0.999664	CS pos: 19-20. Pr: 0.9727

TMHMM  Annotations     

There is no transmembrane helices in Bcin01g11220.1:RNA-p1.