CAZyme Information: Bcin01g09430.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin01g09430.1:RNA-p1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
235		24094.17	4.9131

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_1:3279496-3280494(-)

Full Sequence      

MRFSIPLLLSVSSLAFALPVAESEVNTATESQVTTTEHLATTAHFFEKAAAVVTTENGLT
TDACKPVIVIFARGTNEEGNVGQDVGPYVFTDLRAALTTAKVTVQGVEYSASVLGYLVGG
DSAGSTSMANLTNYASTKCPSAKLVLSGYSQGAQLVHNAAKTLSAAVTAKIAAVVMFGDP
DYGQAVGTVPSSKVLSICHDQDIICTGSGGFTTHLTYSDDAPTASAFIVKAVGSV

Enzyme Prediction     

No EC number prediction in Bcin01g09430.1:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	63	231	5.7e-43	0.9894179894179894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	1.59e-57	63	232	1	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ46322.1|CE5	4.81e-158	1	235	1	235
CCD42307.1|CE5	4.81e-158	1	235	1	235
APA06425.1|CE5	1.83e-121	1	235	1	246
QSZ35346.1|CE5	4.86e-107	1	235	1	244
VCU39288.1|CE5	1.51e-62	3	232	6	236

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	4.54e-44	62	232	77	247	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
1CUZ_A	5.33e-22	63	235	30	210	Chain A, CUTINASE [Fusarium vanettenii]
1FFD_A	1.04e-21	63	235	30	210	Chain A, CUTINASE [Fusarium vanettenii]
1FFC_A	1.04e-21	63	235	30	210	Chain A, CUTINASE [Fusarium vanettenii]
5X88_A	2.06e-21	56	217	15	183	Chain A, cutinase [Malbranchea cinnamomea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8X1P1|CUTI_BLUHO	6.14e-62	3	232	6	236	Cutinase OS=Blumeria hordei OX=2867405 GN=CUT1 PE=3 SV=1
sp|Q8TGB8|CUTI_MONFR	9.13e-48	63	234	30	201	Cutinase OS=Monilinia fructicola OX=38448 GN=CUT1 PE=2 SV=1
sp|Q00298|CUTI_BOTFU	1.33e-47	63	233	30	201	Cutinase OS=Botryotinia fuckeliana OX=40559 GN=cutA PE=1 SV=1
sp|A8QPD8|CUTI1_TRIHA	2.83e-46	62	232	77	247	Cutinase cut1 OS=Trichoderma harzianum OX=5544 GN=cut1 PE=1 SV=1
sp|Q9Y7G8|CUTI_PYRBR	7.00e-45	64	227	32	196	Cutinase pbc1 OS=Pyrenopeziza brassicae OX=76659 GN=pbc1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000491	0.999480	CS pos: 17-18. Pr: 0.9358

TMHMM  Annotations     

There is no transmembrane helices in Bcin01g09430.1:RNA-p1.