CAZyme Information: Bcin01g08910.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin01g08910.1:RNA-p1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341	bcin_chr_1|CGC9	37105.45	5.0079

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_1:3095049-3096232(-)

Full Sequence      

MASLRLTTVLAIASFLASVQGAPLAQDAQKHCSATSHWPGWNKLQYAFVFGDSYTTTGFE
TNGTQPTPTNPLGNPPYPGYSATNGQNWVDFLTVKYNKSTVLTYNLAYGGATVNSDLVAP
YKPEVSSIANQIENQFFPTYAGKPEIAPWSSGNTLFAIFDGINDVGNSYFLGAPATANLN
ERIMAVYHGLVDELYYIGARNFAFLNVPPVDRSPLSISGGAAAQAQEKLDIADWNNRLAT
LAQSLKKTFTDVNVFTVDAHSLFTKVLDNPKSFPQTSVYHNTTAYCVAYENGTPTPNYSD
PSCYIPVNEYFWLNSLHPTYPMHDVLAQGVATVLESGPNVC

Enzyme Prediction     

No EC number prediction in Bcin01g08910.1:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	49	330	1.4e-74	0.9850187265917603

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	4.93e-63	48	333	3	270	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
225780	COG3240	1.33e-16	11	335	5	334	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
238875	SGNH_plant_lipase_like	1.65e-14	48	319	4	300	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238883	Triacylglycerol_lipase_like	8.80e-11	48	334	5	281	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
395531	Lipase_GDSL	1.37e-07	48	284	2	215	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ46260.1|CE16	1.10e-257	1	341	1	341
APA06788.1|CE16	7.95e-226	1	341	1	341
UJO22905.1|CE16	1.20e-120	14	336	10	330
QRC99106.1|CE16	1.03e-108	23	335	10	322
CBY01773.1|CE16	2.33e-104	21	339	13	330

PDB Hits     

Bcin01g08910.1:RNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QJ27|AES1_MYCTT	7.77e-59	45	331	32	294	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1
sp|T2FKR1|AES1_THETO	2.41e-57	45	331	32	294	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000203	0.999787	CS pos: 21-22. Pr: 0.9822

TMHMM  Annotations     

There is no transmembrane helices in Bcin01g08910.1:RNA-p1.