CAZyme Information: Bcin01g02970.1:RNA-p1

Basic Information

• Species: Botrytis cinerea
• Lineage: Ascomycota; Leotiomycetes; ; Sclerotiniaceae; Botrytis; Botrytis cinerea
• CAZyme ID: Bcin01g02970.1:RNA-p1
• CAZy Family: AA1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
412		41043.42	6.6316

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BcinereaB05-10	12073	332648	366	11707

• Gene Location: location=bcin_chr_1:1088768-1090006(-)

Full Sequence      

MQFTNSLALGAVLCASVINAHMSLTWPLPFRSKLNPNSVQSQIDYSITAPLEASGSNFPC
KYNDMGTAGGKSVVTWSAGQTANWTVGTGAIHGGGSCQVALSYDSGKTFRVIHSYIGSCP
VAVDSSADFTVPADAPAGEAMFAWTWQNEVGNREFYMSCAAVTIEATKTRAAPAVAFSSR
PDLFLVNLNNGCTSVENKAVNYPNPGPDADVTRKTSDSGTFTGTCGPVNGVASSGSDASG
SASGSTGGESSSAPVASVSSAPAGSAPYASVAPVSSAPAGSAPYASVPVASPSTTPVSIV
ILPTIAASSTLSSATVIATSAQASPTSSTASPSSSGTSSGALQASVDGLCSAGKTCTGSG
FGPCCSREGFCGIGDAWCGTGCQPGFGSCGSTLNSTSTANPIRKIRGRSWRV

Enzyme Prediction     

No EC number prediction in Bcin01g02970.1:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA11	21	213	4.6e-62	0.9738219895287958

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
211316	ChtBD1_1	6.40e-13	351	390	5	44	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
395135	Chitin_bind_1	8.03e-06	353	383	8	35	Chitin recognition protein.
211311	ChtBD1	1.14e-04	353	385	8	37	Hevein or type 1 chitin binding domain. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
214593	ChtBD1	6.52e-04	353	385	8	37	Chitin binding domain.
211312	ChtBD1_GH19_hevein	0.004	351	383	7	36	Hevein or Type 1 chitin binding domain subfamily co-occuring with family 19 glycosyl hydrolases or with barwin domains. This subfamily includes Hevein, a major IgE-binding allergen in natural rubber latex. ChtBD1 is a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ45530.1|AA11|CBM18	6.06e-259	1	412	1	412
CCD54857.1|AA11|CBM18	3.50e-258	1	412	1	412
APA06639.1|AA11|CBM18	2.21e-188	1	412	1	399
QSZ30312.1|AA11	1.31e-131	1	236	1	238
UKZ51854.1|AA11	6.85e-70	1	210	1	211

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAH_A	3.14e-24	21	206	1	196	Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Zn [Aspergillus oryzae],4MAI_A Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Cu(I) [Aspergillus oryzae]

Swiss-Prot Hits     

Bcin01g02970.1:RNA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000258	0.999700	CS pos: 20-21. Pr: 0.9718

TMHMM  Annotations     

There is no transmembrane helices in Bcin01g02970.1:RNA-p1.