CAZyme Information: B9J08_003459-t37_1-p1

Basic Information

• Species: [Candida] auris
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] auris
• CAZyme ID: B9J08_003459-t37_1-p1
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356	PEKT02000007|CGC4	42140.25	7.0002

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CaurisB8441	5584	N/A	167	5417

• Gene Location: location=PEKT02000007:1785510-1786580(+)

Full Sequence      

MSFPLEHTRGYEQDRVEFTVGDDTYHNTYKPQKKSWLSGPKRILSGIAEDISDVIVTHKK
FMLCVAVFLFLSFFTSMPYVPHLFHNGDPKVVIILAANEGGGVFKWKGPQEWSVERSSIA
NKKAYAKRHGYGLTIKDMTSKKRYSHEWRESWEKVDLMKQAMRQFPNTEWFWWLDLHTYI
MEPHKSLESHLLNKLDNITYRTLDTFNPINLKVPLPLVDYTAPIDMVVTQDCGGFNLGSF
LLRRSEWTDMLLDIWWDPAMYEQMHMQWEHKEQDSLETLYESQPWIRERVGFVPLRTINA
FPPGACADKADDPQYFYHRGDFLINMAGCEFGRDCWGEMEHYKALSRKLQKWWRIW

Enzyme Prediction     

No EC number prediction in B9J08_003459-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	89	337	5.7e-85	0.9878048780487805

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	6.05e-83	87	335	1	238	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215617	PLN03182	4.87e-04	118	255	152	265	xyloglucan 6-xylosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWW21810.1|GT34	4.30e-283	1	356	1	356
QEL58602.1|GT34	4.30e-283	1	356	1	356
QRG36928.1|GT34	4.13e-281	1	356	1	356
QEO21172.1|GT34	9.01e-273	1	350	1	350
QWU88143.1|GT34	9.63e-249	6	356	1003	1353

PDB Hits     

B9J08_003459-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P50108|MNN10_YEAST	4.98e-140	84	353	115	386	Probable alpha-1,6-mannosyltransferase MNN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN10 PE=1 SV=1
sp|P78817|YFE6_SCHPO	6.77e-104	88	352	72	340	Uncharacterized alpha-1,2-galactosyltransferase C637.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC637.06 PE=2 SV=2
sp|O94622|YBKD_SCHPO	2.76e-31	85	350	98	354	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q09174|GMA12_SCHPO	1.65e-26	85	350	98	354	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|Q10359|GMH3_SCHPO	2.48e-19	88	343	83	328	Alpha-1,2-galactosyltransferase gmh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999729	0.000288

TMHMM  Annotations     

Start	End
61	83