CAZyme Information: B9J08_000963-t37_1-p1

Basic Information

• Species: [Candida] auris
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] auris
• CAZyme ID: B9J08_000963-t37_1-p1
• CAZy Family: GH132
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
432		49992.66	9.2777

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CaurisB8441	5584	N/A	167	5417

• Gene Location: location=PEKT02000002:1001451-1002749(+)

Full Sequence      

MLTLRLRPKSKVASDSGAFLPEPATFKGMRPRSNKIVLLLIVFTLLWFFNPLRWMAVPWT
RNGTTYTAPKPYMSEFTIETPSKYIFPPVDHVPQLKELGAAGLVRQVRIKDPDMPEVEKT
LFQSLNVYDDKDPVTSKQRDEAEAALSGEAAVKVAFKNQDKMVYKPKTMKNYPKVVIVTA
VDFDQYSIEAITKIVQNRVDYGHKQNYGVYVRWYQEFVPLMNSLAFLTDKERSKWVRLYC
LRAAMFAFPHAEWFWYFDQHGFVMNQNVDLINYLLDTDALKKSMLIEQPVIPPDGLIRTY
KNISPSRVRLIFTQSDQKIESNSFIVKNDFLGRGLLDTWGDRLFVKYNNFPYGPESAITH
ILQWHPFALSRSAIVPARTINSLHSEVTPKEESKDQLHYHKGDLVVQWSSCETPLKCEEI
LNGYHTIMKSEN

Enzyme Prediction     

No EC number prediction in B9J08_000963-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	173	418	2.8e-66	0.983739837398374

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	8.65e-49	173	417	3	238	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215617	PLN03182	2.58e-05	166	360	120	276	xyloglucan 6-xylosyltransferase; Provisional
215616	PLN03181	0.002	196	258	155	206	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWW23700.1|GT34	0.0	1	432	1	432
QEO20536.1|GT34	0.0	1	432	1	432
QEL60804.1|GT34	0.0	1	432	1	432
QRG37634.1|GT34	0.0	1	432	1	432
QWU87725.1|GT34	4.89e-208	71	431	330	690

PDB Hits     

B9J08_000963-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P46985|MNN11_YEAST	1.91e-53	26	430	27	422	Probable alpha-1,6-mannosyltransferase MNN11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN11 PE=1 SV=2
sp|O13640|YGWH_SCHPO	1.03e-23	155	429	45	311	Uncharacterized alpha-1,2-galactosyltransferase C8D2.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi048 PE=3 SV=2
sp|O94622|YBKD_SCHPO	3.77e-21	191	428	124	350	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q09174|GMA12_SCHPO	3.59e-19	194	431	127	353	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|Q09679|GMH1_SCHPO	5.59e-16	171	424	80	324	Probable alpha-1,2-galactosyltransferase gmh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999940	0.000078

TMHMM  Annotations     

Start	End
36	57