CAZyme Information: B9J08_000709-t37_1-p1

Basic Information

• Species: [Candida] auris
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] auris
• CAZyme ID: B9J08_000709-t37_1-p1
• CAZy Family: GH125
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
283	PEKT02000002|CGC5	29887.12	4.4556

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CaurisB8441	5584	N/A	167	5417

• Gene Location: location=PEKT02000002:438038-438889(+)

Full Sequence      

MYFATILTAALVAAAPTKRETTCQFPSDKGLVSITSSKSNAGWALSPDQKCTAGSYCPYA
CPPGKLMAQWDSSAKSYSVGSSMNGGLYCNDDGELSKPFSDKDYCVDGTGTVQVNNKASS
NVAFCQTVLPGNEAMLIPTNVDGGDTETLAVPDESYYASSAAHYYINPLGVSTDEGCVWG
TKDKSVGNWAPYVAGANTDSDGRTFLKIGWNPKYIDDFKDKPSFGIRITCDGNDCDDNSC
EIDPSKDGYNGISGGSTGKSLGASYCVVTAKDKKKATIEVFSV

Enzyme Prediction     

No EC number prediction in B9J08_000709-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	19	275	1.6e-91	0.8250825082508251

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	2.02e-117	18	267	1	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEO22520.1|GH132	5.38e-213	1	283	1	283
QWW23484.1|GH132	5.38e-213	1	283	1	283
QEL60559.1|GH132	6.29e-212	1	283	1	283
QRG37882.1|GH132	1.27e-211	1	283	1	283
QWU89555.1|GH132	1.97e-174	1	283	1	283

PDB Hits     

B9J08_000709-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q04018|YM79_YEAST	5.81e-103	18	283	46	319	Uncharacterized protein YMR244W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YMR244W PE=3 SV=1
sp|O74851|ADG3_SCHPO	3.77e-86	23	280	73	333	Probable secreted beta-glucosidase adg3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=adg3 PE=2 SV=1
sp|A7A003|UTH1_YEAS7	1.57e-39	25	269	116	351	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=UTH1 PE=3 SV=2
sp|B3LRC2|UTH1_YEAS1	1.57e-39	25	269	116	351	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=UTH1 PE=3 SV=1
sp|B5VMJ0|UTH1_YEAS6	1.57e-39	25	269	116	351	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain AWRI1631) OX=545124 GN=UTH1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000266	0.999724	CS pos: 19-20. Pr: 0.9268

TMHMM  Annotations     

There is no transmembrane helices in B9J08_000709-t37_1-p1.