CAZyme Information: An18g04100-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An18g04100-T-p1
• CAZy Family: GT41
• CAZyme Description: Putative exo-beta-1,3-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416	An18_A_niger_CBS_513_88|CGC4	45525.68	4.7781

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An18_A_niger_CBS_513_88:951530-952900(+)

Full Sequence      

MFVESAKKALLALSLLAASAQAVPRVRRQGASSSFDYKSQIVRGVNLGGWLVTEPWITPS
LYDSTGGGAVDEWTLCQILGKDEAQAKLSSHWSSFITQSDFDRMAQAGLNHVRIPIGYWA
VAPIDGEPYVSGQIDYLDQAVTWARAAGLKVLVDLHGAPGSQNGFDNSGHRGPIQWQQGD
TVNQTMTAFDALARRYAQSDTVTAIEAVNEPNIPGGVNEDGLKNYYYGALADVQRLNPST
TLFMSDGFQPVESWNGFMQGSNVVMDTHHYQVFDTGLLSMSIDDHVKTACSLATQHTMQS
DKPVVVGEWTGALTDCAKYLNGVGNAARYDGTYMSTTKYGDCTGKSTGSVADFSADEKAN
TRRYIEAQLEAYEMKSGWLFWTWKTEGAPGWDMQDLLANQLFPTSPTDRQYPHQCS

Enzyme Prediction     

EC	3.2.1.58:29	3.2.1.21:6	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	90	386	7.1e-117	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	2.81e-72	36	416	12	395	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	3.40e-11	94	315	23	242	Cellulase (glycosyl hydrolase family 5).
396834	Glyco_hydro_42	0.003	91	152	6	64	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK43212.1|GH5_9	4.12e-316	1	416	1	416
BCS10323.1|GH5_9	2.76e-305	1	416	1	416
BCR97869.1|GH5_9	2.76e-305	1	416	1	416
QMW28378.1|GH5_9	1.00e-203	1	415	1	415
QRD82870.1|GH5_9	1.00e-203	1	415	1	415

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2PB1_A	2.54e-120	30	415	3	397	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
1EQP_A	2.95e-120	34	415	1	391	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	5.92e-120	34	415	1	391	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PBO_A	7.21e-120	30	415	3	397	Chain A, Hypothetical protein XOG1 [Candida albicans]
2PC8_A	7.21e-120	30	415	3	397	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2RAR6|EXGA_ASPNC	7.32e-317	1	416	1	416	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
sp|Q7Z9L3|EXGA_ASPOR	5.24e-199	32	415	21	405	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
sp|B8N151|EXGA_ASPFN	5.24e-199	32	415	21	405	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
sp|B0XN12|EXGA_ASPFC	3.16e-198	1	416	1	416	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|Q4WK60|EXGA_ASPFU	3.16e-198	1	416	1	416	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000285	0.999694	CS pos: 28-29. Pr: 0.7446

TMHMM  Annotations     

There is no transmembrane helices in An18g04100-T-p1.