CAZyme Information: An18g00730-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An18g00730-T-p1
• CAZy Family: GT34
• CAZyme Description: Ortholog of A. niger CBS 513.88 : An04g04630, A. oryzae RIB40 : AO090011000122, Aspergillus wentii : Aspwe1_0121345 and Aspergillus niger ATCC 1015 : 190360-mRNA, 54079-mRNA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
430		48946.98	6.3170

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An18_A_niger_CBS_513_88:155421-156713(+)

Full Sequence      

MTFRRPRIWRRFLLILGASAILFLLCRNDKPRWLAARRAHSSCTGFDLAAVSEDLHSRMK
AESDYTPVEIHQFVCGIINHNMTASAQLECPATISQRYHSLIPVDGKHPEIQYFFALNLY
QVIHIILPLMGSILEAIRYLGPEHCALSIVEGRSTDGTYEILARLKPELDAMGVRYHFSR
SPINPLGPGENRIKDLSELRNMALEPLITGARQKGGPFGHDPMIIFINDIGICPEDILEL
IYQQKVQDATMTCAFDWREEGVIHDVWVSRDLSGDLFFDISSDGSIWDSHNLFSHHGPSR
ERFVKHLPVQVYSCWGGMVTLDSGPFIDGQVQFRYSEEDECYMGEPTLLAQDLWRLGLGK
VLAIPTVNVAYEYRWSLRAKNEKGYVHTLLGNSGPGRYSPHDELVHWQKEPPKQIKCMPA
WDDQSWVDAV

Enzyme Prediction     

No EC number prediction in An18g00730-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT69	112	354	1.4e-78	0.9916317991631799

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403053	CAP59_mtransfer	5.24e-91	112	349	1	225	Cryptococcal mannosyltransferase 1. The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1, EC:2.4.1.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK43148.1|GT69	0.0	1	430	1	430
BCR98251.1|GT69	1.96e-304	1	430	1	425
BCS10594.1|GT69	1.96e-304	1	430	1	425
BAE64674.1|GT69	2.00e-149	42	430	60	447
QRD91215.1|GT69	8.50e-149	42	430	72	459

PDB Hits     

An18g00730-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6U1Z4|CMT1_CRYNJ	1.08e-44	112	427	128	461	Alpha-1,3-mannosyltransferase CMT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.996248	0.003778

TMHMM  Annotations     

Start	End
7	26