CAZyme Information: An16g09090-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An16g09090-T-p1
• CAZy Family: GT32
• CAZyme Description: Has domain(s) with predicted hydrolase activity, hydrolyzing O-glycosyl compounds activity and role in carbohydrate metabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1107	An16_A_niger_CBS_513_88|CGC15	120116.73	8.0017

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An16_A_niger_CBS_513_88:2066739-2070677(+)

Full Sequence      

MIYLLPRDFLSHRAQSIRLYTLAFDNFDFMPLELLAPSQPVVSAAVNRISDRQNIASSYL
VTYLVEGSLVSTAGAGAPVRPLFFDVCNRLPYSLGLPRFRPISGCVSVPYLQRLSPISPT
TAATITAATITAATATYPIHHPETRFLYFAIAPATFLPTPGSHGPQRGHVAAWLGGSRQD
VTLLALVGLILSSIPSIHPSPSLFRFPLSTFITLKKHPLPSSLPFYPSIMADAAEDATRL
VLELQTIARDAGHPVPLLIALDQENGGVNSLYDEIYIRQYPSAMGIAATGSKTLAHEVAT
ATAQELKAVGVNWILGPVLDVLTNVRSQPLGVRTTGDDPQEVSQYGVEFMKGYQKAGLVT
CGKHFPSYGNLEFLGSQTDVPIITESLEQLSLTALVPFRNAIVQGLDSMMVGGVSMSSAG
VNVMHACLSEQVVDDLLRKDLKFEGVVVSECLEMEALTHNIGVGGGTVMAKNAGCDIILL
CRSFQVQQEAINGLKLGVENGIIGRARIEQSLRRVLKLKAKCTSWERALNPPGIPSLTQM
QPSHTSLSTRAYNSSISVVRDKKNLLPLSNILESNEELLLLTPLVKPLPASAVSRSVSEH
SNMSLDPISWDRTASVLSGESVFKELGRSLSRQRSGRVLHTSYTANGVRPIHENLIDRAN
AVIVVTADANRNLYQHGFTKHVSMICRSQFTPSGEAREKPLIVVAASSPYDFAMDPSIGT
YICTYDFTETALEALVKVLYGELNPVGSLPGSISRSQKLHQARQHWLVETWNEERDARSL
DSLLDAVRGDCAQGQRSELLGVTSSSFLLRREEIDEAHFVVRNSSTQALYGFCSTYFFRS
TGTGVIGSLIVHPARRKLSIGNSLHSRAIRTLLQRKGVKRFQLGSRLPGIYLGIPSANPV
ERKRLRQWFANLGWNTALSRPVCSVVLRNLTTWTPPDGLIFGLQNADVTYDLVHGWDHAD
SILDHIKTNSRQGVIDIYRVALGGAPHCGIIRATRPGDGAILGSVVIYNGRATLAEHMPA
LKSTQVPAGGISSPVISPSVGEYATVMQGLVLLGIKQIRKQGAEAVIMDSVDVDGNFECL
SGLGFSTLHSFEEVNCDAATWTMVPGP

Enzyme Prediction     

No EC number prediction in An16g09090-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	254	479	1e-53	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.51e-63	212	569	22	351	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	2.01e-53	235	518	46	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	1.19e-29	249	514	50	308	beta-hexosaminidase; Provisional
178629	PLN03080	1.96e-12	280	750	114	585	Probable beta-xylosidase; Provisional
185053	PRK15098	1.74e-07	279	519	119	353	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK47105.1|GH3	0.0	1	1107	1	1107
BCS15461.1|GH3	0.0	233	1106	57	930
BCS03847.1|GH3	0.0	233	1106	39	912
BAE65506.1|GH3	0.0	233	1104	86	958
QRD92904.1|GH3	0.0	233	1104	39	911

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	2.55e-73	189	914	16	679	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	3.19e-52	230	754	53	532	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	8.52e-34	238	753	99	617	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.21e-33	238	753	73	591	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.59e-33	238	753	103	621	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	4.39e-33	238	753	99	617	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q7WUL3|NAG3_CELFI	2.83e-32	234	750	67	552	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
sp|P48823|HEXA_PSEO7	5.03e-27	244	754	87	597	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|Q3SKU2|NAGZ_THIDA	2.30e-23	256	508	58	308	Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=nagZ PE=3 SV=1
sp|B0U3L0|NAGZ_XYLFM	3.07e-22	241	505	40	306	Beta-hexosaminidase OS=Xylella fastidiosa (strain M12) OX=405440 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000008

TMHMM  Annotations     

There is no transmembrane helices in An16g09090-T-p1.