CAZyme Information: An16g06590-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An16g06590-T-p1
• CAZy Family: GT31
• CAZyme Description: Has domain(s) with predicted catalytic activity, glucosidase activity and role in carbohydrate metabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396	An16_A_niger_CBS_513_88|CGC5	43454.04	5.4882

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An16_A_niger_CBS_513_88:1450238-1451727(+)

Full Sequence      

MPATEAASTVHSPPVSHSIPPPMNLVLHGFSSVPGLVAGNGHDCHFPIHATPACPLADYR
CLHGRPSYTCSCLNFCQTELSTQLFRHIRSSSAGGAADSIPCRAHLSRGGHFFSFELEDE
GYSYKNLKGQSQALETILAEAGINSVRQRVWGQFQSWHLQFGLQLGAGKRVKAAGMSIYL
DLHLNNNIDIEIISIGNEIRAGLLWPLGETSSYSNIGALLYSGAWGVKDSNLATLPKIII
HLDDGWSWDQQSYFYKTVLSTGELLNTDFDYFGVLYYLFYSASVNIASLKTSLANLQSIY
NKPVVVVEMNWPVPCPNPEYSCFSDPRLISFSVAGQQQFLEKLAAVVEATTDGQGVYYWE
PAWITNAGVGSSCDENLMVDRSTDEVYASFDILGKL

Enzyme Prediction     

EC	3.2.1.89:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	185	386	9.3e-45	0.6081871345029239

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
311610	Glyco_hydro_53	9.00e-78	116	393	11	333	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
226385	GanB	5.16e-33	116	364	50	345	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK46993.1|GH53	1.76e-300	1	396	1	396
AAA32692.1|GH53|3.2.1.89	7.27e-147	117	396	31	350
CAB40555.1|GH53|3.2.1.89	6.06e-121	118	396	32	350
CAK43317.1|GH53|3.2.1.89	1.83e-117	118	396	32	350
CAC83735.1|GH53|3.2.1.89	5.21e-117	118	396	32	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1FHL_A	1.43e-148	117	396	15	334	Crystal Structure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 293k [Aspergillus aculeatus],1FOB_A Crystal Structure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 100k [Aspergillus aculeatus],6Q3R_A ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus],6Q3R_B ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus]
4BF7_A	5.64e-102	118	396	33	350	Emericilla nidulans endo-beta-1,4-galactanase [Aspergillus nidulans]
1HJS_A	6.18e-85	118	382	16	319	Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
1HJQ_A	1.11e-82	118	382	16	319	Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Humicola insolens]
1R8L_A	5.27e-14	117	364	36	325	The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P48842|GANA_ASPAC	1.29e-147	117	396	31	350	Arabinogalactan endo-beta-1,4-galactanase OS=Aspergillus aculeatus OX=5053 GN=gal1 PE=1 SV=1
sp|Q9Y7F8|GANA_ASPTU	1.08e-121	118	396	32	350	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus tubingensis OX=5068 GN=galA PE=2 SV=1
sp|A2RB93|GANA_ASPNC	3.26e-118	118	396	32	350	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=galA PE=3 SV=1
sp|Q8X168|GANA_ASPNG	9.26e-118	118	396	32	350	Arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus niger OX=5061 GN=galA PE=1 SV=1
sp|Q0CTQ7|GANA_ASPTN	1.11e-105	118	394	30	347	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=galA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000012

TMHMM  Annotations     

There is no transmembrane helices in An16g06590-T-p1.