CAZyme Information: An16g00540-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An16g00540-T-p1
• CAZy Family: GT25
• CAZyme Description: Has domain(s) with predicted catalytic activity

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
497	An16_A_niger_CBS_513_88|CGC12	54844.15	4.9352

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An16_A_niger_CBS_513_88:107569-109157(-)

Full Sequence      

MRRLLYNALVAAIPLALANFDASHVSWYTTPANNFTSTLPIGNGRLGAAIWGTATENVTL
NENSIWSGPFINRVNPRSYDALWPVRSLLAEGNMTEGNDATLANMVGIPDSPQSYSALGS
LVLDFGHDEAGISNYTRYLDLRSGMAVVEYTYRAVRYRREYLASHPDNVVAVRLSSSEPG
GLNVASSLVRDRYVVSNNATLSHDGGLLTLRAYSNNVSNPIQFTAEARVVSDGRATSNGT
SLVVRNASTIDIFIDTETSYRYSAQENWEAEIKSKLDTACSSGFVAVKKNAIADYSALAQ
RVDLNLGSSGSAGNLPTDSRLVNYRIDPDSDPELVVLMFHFGRHSLIASSRATESPALPA
NLQGLWNQDFDPAWGGRFTIDINLEMNYWPAEVTNLADTFSPFIDLLDVVHDRGLDVAES
MYHCSNGGYVLHHNTDLWGDAAPVDNGTTWTMWPMGGAWLSANLIEHYRFSRDESILRNR
IWPLLQSAARFYYCYLF

Enzyme Prediction     

EC	3.2.1.-:3	3.2.1.63:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH95	24	496	4.9e-144	0.6301939058171745

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
405224	Glyco_hyd_65N_2	1.21e-63	27	261	2	232	Glycosyl hydrolase family 65, N-terminal domain. This domain represents a domain found to the N-terminus of the glycosyl hydrolase 65 family catalytic domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK46741.1|GH95	0.0	1	497	1	497
BCS03163.1|GH95	0.0	6	497	5	496
BCS14803.1|GH95	0.0	6	497	5	496
QRD89273.1|GH95	8.19e-225	15	497	15	497
QMW24829.1|GH95	8.19e-225	15	497	15	497

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7KMQ_A	3.33e-74	27	492	44	500	Chain A, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306],7KMQ_B Chain B, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306]
2RDY_A	3.13e-72	31	491	10	484	Chain A, BH0842 protein [Halalkalibacterium halodurans C-125],2RDY_B Chain B, BH0842 protein [Halalkalibacterium halodurans C-125]
4UFC_A	3.52e-72	27	492	25	479	Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus],4UFC_B Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus]
2EAE_A	3.32e-58	28	496	38	545	Chain A, Alpha-fucosidase [Bifidobacterium bifidum]
2EAB_A	3.35e-58	28	496	39	546	Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAB_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAC_A Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum],2EAC_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8L7W8|FUCO2_ARATH	6.07e-64	31	491	59	541	Alpha-L-fucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=FUC95A PE=1 SV=1
sp|A2R797|AFCA_ASPNC	3.01e-44	4	492	2	499	Probable alpha-fucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=afcA PE=3 SV=1
sp|Q5AU81|AFCA_EMENI	1.51e-31	41	492	46	518	Alpha-fucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afcA PE=1 SV=1
sp|Q2USL3|AFCA_ASPOR	1.93e-29	15	439	12	443	Probable alpha-fucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=afcA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000254	0.999725	CS pos: 18-19. Pr: 0.9756

TMHMM  Annotations     

There is no transmembrane helices in An16g00540-T-p1.