CAZyme Information: An16g00500-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An16g00500-T-p1
• CAZy Family: GT24
• CAZyme Description: Ortholog of A. fumigatus Af293 : Afu3g10850, A. oryzae RIB40 : AO090102000071, Neosartorya fischeri NRRL 181 : NFIA_032600 and Aspergillus wentii : Aspwe1_0045718

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
456	An16_A_niger_CBS_513_88|CGC11	52544.10	6.9578

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An16_A_niger_CBS_513_88:99209-100645(+)

Full Sequence      

MWRHMKFSAFHIVTLALAALLGISIWSLWLGVNSDRDNIHPLLNQLIPAGHCACHTAAIF
ECDSCLRCPAQLPFHDTVSSSSAPPTRTFFDPLEYSYNETQCTTLFPGLFEDPIRAQSFW
TARHGIKRIDIDNIKMADGMARVAIYQGRLYVLRALAKGEDHRRKILGILASIHRALVSA
PQLAVILNTEIIFSVEDKLEDVAGPDHPLWVLARKATEESVWLMPDFGFWSWGHIDTQIG
PYDEVVKHVEEHEHPWDEKENKLVWRGKLSFAPKLRRALLEIARNYAWADVKEVEWKNKA
NYLSMDNHCDYRFIAHVEGRSYSASLKYRQACRSVIVIHELQYIQHHHYLLVSSGPQQNF
VQVERDWTDLPHKIQELLDNPIKARMIADNNVDVFRERYLTPAADACYWRALLQGWTTAS
PQITETMSDPTNVSNKGIRYESFLLLDPSNMMRFRP

Enzyme Prediction     

No EC number prediction in An16g00500-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	190	417	6.1e-18	0.956

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
310354	Glyco_transf_90	1.52e-16	223	414	122	317	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
214773	CAP10	1.14e-14	223	416	46	249	Putative lipopolysaccharide-modifying enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW35140.1|GT0	1.89e-307	1	454	1	453
QRD91520.1|GT0	1.89e-307	1	454	1	453
QMW31874.1|GT0	1.77e-205	20	454	22	454
QRD90937.1|GT0	1.77e-205	20	454	22	454
UDD60835.1|GT0	7.19e-205	20	454	22	454

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	3.64e-06	177	414	125	373	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0X1Q4|RUMI_CULQU	2.71e-07	208	414	162	383	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q16QY8|RUMI_AEDAE	4.57e-06	211	414	164	382	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999732	0.000303

TMHMM  Annotations     

Start	End
7	29