CAZyme Information: An15g05350-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An15g05350-T-p1
• CAZy Family: GT20
• CAZyme Description: Has domain(s) with predicted hydrolase activity, hydrolyzing O-glycosyl compounds activity and role in carbohydrate metabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
443	An15_A_niger_CBS_513_88|CGC2	49904.03	5.1843

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An15_A_niger_CBS_513_88:1257322-1259027(+)

Full Sequence      

MLYLRHAWLLGALANLVAADETDCNPLNTTCPADAALSTEHTWWFNETLDDKLWDMQTGE
IEYTSEGADFSIKTENASTLLVSNFYIFFGVMEAHVKMAKGAGIISSVILQSDDLDEIDW
EWVGYNTSQVQSDFFGKGNTTTSDRGGYHAVENADTEFHNYTSYWDKDRLEWWIDGELRR
TVNYSEPLTVYGKNYPQTPCRVKVSNWPVGIPSQSVGNIEWGGGLVNWTNLPFTMTVQKI
RVQDFSSGKEYEYIGHNGSYDSIKVVSGNSTAAKEISKAPAKSLSQKWDDLGTAAHIGVY
CGAAAFAALCIAGFVLYFLRQRRQGRLERALGEGQGGAAVDPTEMETYKKQWRQSDWTTR
RGYQAMERIFDHKAKQLIRTDSEIPAEDNLLGWLLCKHSHTIHPMIYTPLSCKEVKFALV
ATQETITRFLCARLLTLYSVSTE

Enzyme Prediction     

No EC number prediction in An15g05350-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	66	224	4.5e-62	0.9873417721518988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185692	GH16_fungal_CRH1_transglycosylase	1.18e-103	43	246	1	203	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	4.95e-43	58	229	3	167	Glycosyl hydrolases family 16.
185683	Glyco_hydrolase_16	7.86e-18	85	242	63	209	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	3.05e-16	89	208	68	184	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
185693	GH16_laminarinase_like	7.43e-08	52	242	53	234	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK42508.1|GH16_18	0.0	1	443	1	443
BCS01959.1|GH16_18	6.62e-260	1	366	1	365
BCS13651.1|GH16_18	6.62e-260	1	366	1	365
UDD62188.1|GH16_18	1.64e-216	5	367	5	366
QMW42497.1|GH16_18	5.32e-216	5	367	37	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IBU_A	4.56e-63	24	264	4	243	Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBU_B Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBW_A Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293],6IBW_B Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293]
1GBG_A	3.98e-10	89	223	72	194	Bacillus Licheniformis Beta-Glucanase [Bacillus licheniformis]
3D6E_A	5.98e-10	89	223	59	181	Crystal structure of the engineered 1,3-1,4-beta-glucanase protein from Bacillus licheniformis [Bacillus licheniformis],3D6E_B Crystal structure of the engineered 1,3-1,4-beta-glucanase protein from Bacillus licheniformis [Bacillus licheniformis]
3O5S_A	5.96e-09	89	223	96	218	Crystal Structure of the endo-beta-1,3-1,4 glucanase from Bacillus subtilis (strain 168) [Bacillus subtilis]
4DFS_A	6.24e-08	85	186	100	214	Structure of the catalytic domain of an endo-1,3-beta-glucanase (laminarinase) from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],4DFS_B Structure of the catalytic domain of an endo-1,3-beta-glucanase (laminarinase) from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B4J2|CRH12_ARTBC	6.82e-87	13	352	20	356	Probable extracellular glycosidase ARB_03382 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03382 PE=3 SV=2
sp|D4ALQ5|CRH11_ARTBC	2.17e-62	7	300	7	293	Probable extracellular glycosidase ARB_05253 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05253 PE=1 SV=2
sp|Q8J0P4|CRF1_ASPFU	8.59e-61	10	264	10	264	Probable glycosidase crf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf1 PE=1 SV=2
sp|P53301|CRH1_YEAST	3.34e-59	24	269	40	281	Probable glycosidase CRH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRH1 PE=1 SV=1
sp|Q5AFA2|CRH11_CANAL	2.02e-50	19	284	19	281	Extracellular glycosidase CRH11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRH11 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000238	0.999729	CS pos: 19-20. Pr: 0.9716

TMHMM  Annotations     

Start	End
297	319