CAZyme Information: An14g03520-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An14g03520-T-p1
• CAZy Family: GH92|GH92
• CAZyme Description: Putative endomannanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
457		49602.12	4.1664

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An14_A_niger_CBS_513_88:877110-878820(+)

Full Sequence      

MRLVRDCLYGGLFLNTALFSQLSHAIDIDISSTSSIKDAASKTAYGSMTWYHGNETGQIP
GAFPSKWWEGSALFTSLLLYWYYTGDSTYNDEVRQGMQWQAGDCDYMPANYSSYLGNDDQ
MFWGLAAITAAEIEFADSSSGYSWLALAQGVYNTQIDRWDDSTCGGGLRWQIYPYEAGYA
MKNSISNGGLFQLAARLARYTSNDTYADWAEKIFDWCASTPLLNNETWNVADSTDVDNSC
STQGNNQWSYNYGVFLTGAAYMYNYTGKAKWKTAAEGLLNVTLDTFFPAKYGGNIMSEIL
CEPTEVCNDNEILFKGLVTGWLGLVALVMPSTYDSILPKLQGSAEAAAASCSGMSNNTCG
VRWWPKKWDGWNGMEEEIAVTNVLSSALVNTKKTAPVTSSTGGNSSSDPNAGTGDNTGSS
GSTESKITTGDKAGASILTIAFVGMWGGMIAWMVIGG

Enzyme Prediction     

No EC number prediction in An14g03520-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	31	398	3.9e-101	0.9664804469273743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	1.95e-168	35	380	1	347	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	2.46e-04	144	330	97	282	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK46589.1|GH76	0.0	1	457	1	457
BCS11652.1|GH76	0.0	1	457	1	457
BCR99351.1|GH76	0.0	1	457	1	457
BAE65580.1|GH76	8.67e-235	1	456	1	455
UDD65266.1|GH76	1.01e-233	1	456	1	455

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	5.52e-93	30	412	30	425	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	1.24e-104	20	413	16	409	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	2.83e-104	14	412	9	407	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q5AD78|DCW1_CANAL	1.93e-101	11	414	4	413	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	4.51e-98	1	413	1	406	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q9P6I3|YHG7_SCHPO	5.59e-95	30	415	24	405	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000280	0.999669	CS pos: 25-26. Pr: 0.9726

TMHMM  Annotations     

Start	End
433	455