CAZyme Information: An14g02070-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An14g02070-T-p1
• CAZy Family: GH78
• CAZyme Description: Ortholog(s) have acetylxylan esterase activity and role in xylan catabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383		42946.56	4.5461

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An14_A_niger_CBS_513_88:524173-525928(-)

Full Sequence      

MRLSPIYALSWALQASATILQNGQVREDPYPGQAKAISLDDGSWRTYQPDASEIAYKGRW
DSKYVSCEPSRADYIIWVLLPGIKLGFTGEQLASQTGAMDKFIDPSSRCLLTFRTVQLAG
VSVASDSQLVTVPQYNKTVEIIGDSFASGQYGTYEGLSSWAYNYAAGLGDVEYSITAYPG
ICLTDEQCYADKARGMTHQWFYASDAGVRANATYGNQPEKWDFSAHRAADLVIIDLGTND
HRAVNDIPGSTFYDSYVELVTSVHETWPDAQIVIMSLWGNFTRSGDTYVQSPFYVSEIQR
VAEHFQDDGFVYYFDTKGVLQHNDIDPQEHPTDVGHIKVASHLMQWTKLKLGWEFGATGP
EVQHDTLYWNNEDSYRRSFTGSY

Enzyme Prediction     

No EC number prediction in An14g02070-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	140	345	2e-21	0.9760765550239234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	4.20e-48	139	348	2	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
238141	SGNH_hydrolase	1.77e-14	139	345	1	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	5.95e-14	168	336	2	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
239946	SGNH_hydrolase_like_7	0.002	221	309	13	152	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
395531	Lipase_GDSL	0.003	227	343	77	224	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK41944.1|CE0	2.28e-294	1	383	1	383
BCS11519.1|CE0	1.50e-201	80	383	41	376
BCR99212.1|CE0	2.77e-199	116	383	3	270
QMW34907.1|CE0	1.50e-171	6	378	5	401
QMW46983.1|CE0	1.50e-171	6	378	5	401

PDB Hits     

An14g02070-T-p1 has no PDB hit.

Swiss-Prot Hits     

An14g02070-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000919	0.999053	CS pos: 17-18. Pr: 0.9033

TMHMM  Annotations     

There is no transmembrane helices in An14g02070-T-p1.