CAZyme Information: An13g01960-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An13g01960-T-p1
• CAZy Family: GH76
• CAZyme Description: Has domain(s) with predicted flavin adenine dinucleotide binding, oxidoreductase activity, acting on CH-OH group of donors activity and role in oxidation-reduction process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
600	An13_A_niger_CBS_513_88|CGC1	64710.94	4.8599

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An13_A_niger_CBS_513_88:478506-480554(-)

Full Sequence      

MAAVYDFVIIGGGTAGLVVASRLSEDPNTSVLVLEAGADLTADPRVNIPIFYAALLGSDA
DWKFKSSPQPGLNGRVLGLNQGKTLGGSSSLNAHVFVPPFKGVIDSWEALGNLGWNWTML
RDYFSKAYSSPTVTQDAKEGLAIEGWPELNEAKGPIQTSFGNEAHPIRKAWAELFRNNGQ
YNAGDPFIHSSVGSFSCLASIDSEGKRSNSTSAYYKPVELRHNLHVLTNSLVEKILFDES
KPPRAIGVQYSHDGVSKTFQARNEVILAAGAFQSPKILQLSGVGGAELLEKHGIDIVMDL
PGVGQNLQDHMISYTAFQAKPEIETKDSLVRQEPEAIGQAMQEYAATGSGPLASLGVYTY
AYLSLPDPDRSALQALLSDDTLDNSQQHKATQAYYDIAKTTILDSKQPSAAYLAALGQTN
YSKDLNDGTIPAASPGKFITLGVMLSQPLSRGSVYITSNNPETPPMIDPGYLSNPLDLEV
IARHLLGVKNLAESPQLGELLEQPLKFRDPAADFQGDLDAAKKYARDNLVSMWHFVGTCS
MLPREKDGVVDSSLKVYGIEGLRVVDASAIPLVSTANLQATVYAFAERAADLIKQDWKSE

Enzyme Prediction     

No EC number prediction in An13g01960-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	5	596	1.2e-176	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	8.50e-106	1	594	2	532	choline dehydrogenase; Validated
225186	BetA	6.72e-98	1	596	4	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	5.62e-39	448	589	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	6.58e-32	73	312	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.51e-26	5	582	56	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK41595.1|AA3_2	0.0	1	599	1	560
QMW48092.1|AA3_2	0.0	1	600	1	599
QMW36031.1|AA3_2	0.0	1	600	1	599
QRD93013.1|AA3_2	0.0	1	600	1	599
BCS16880.1|AA3_2	0.0	5	600	6	600

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	4.97e-75	5	599	6	570	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	9.06e-73	5	596	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.34e-71	5	596	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	5.32e-66	5	596	6	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6XUT_A	9.48e-66	5	594	17	588	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A142PTM2|CITC_MONPU	3.56e-91	5	596	14	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	3.56e-91	5	596	14	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	5.87e-88	6	596	15	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	2.16e-80	5	593	47	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	2.16e-80	5	593	47	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999918	0.000128

TMHMM  Annotations     

There is no transmembrane helices in An13g01960-T-p1.