CAZyme Information: An12g07020-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An12g07020-T-p1
• CAZy Family: GH71|CBM24|CBM24
• CAZyme Description: Ortholog of A. nidulans FGSC A4 : AN7534, A. fumigatus Af293 : Afu1g01380/och4, A. niger CBS 513.88 : An14g07140, Aspergillus versicolor : Aspve1_0085820 and Aspergillus clavatus NRRL 1 : ACLA_033030

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421		46694.26	5.7024

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An12_A_niger_CBS_513_88:1675364-1676629(-)

Full Sequence      

MEGSSNRGNNSNPTLFLNRWTLSAGPGAPRIFLISFHLQYPHESSSSCTPSMLPSTLKSS
RYGRFVILTIPLLVFSCLLFLTWDPLPGRLARQQSTSQSDPLSQVPQAVEPPKEEPSQPK
TPVSTSKPSSSKPTADIAGGDAIFGITDKLWQSAKDPHLSDDQDEWISSWLEKNPSFRYE
LLTDTSAATFVRTHYASRPDIIEVFETLPIPILRADLLRYLLVLAEGGVWSDLDVTCDKP
VADWVPTEYKNAKIEMIVGLEFDFEWRGEGTEIASQFCNWVFAAPRSSRVLQVVVDAVVD
KLKEIAAMNNVQVKDLTLEMLPIDVVNVTGPKIMTMAILDSLKQLLGRTVDDRDFHGIKK
PKLIGDVLIMPGVAFAASQNGYPQDQGDALVTHHYAGSWKQADAEAKEKKKQKQNGRDKV
V

Enzyme Prediction     

No EC number prediction in An12g07020-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	165	247	7.3e-20	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	3.60e-17	146	263	82	198	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.14e-14	167	249	8	91	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK46331.1|GT32	4.08e-305	1	421	1	421
BCS02801.1|GT32	4.61e-255	25	421	7	407
BCS14453.1|GT32	1.15e-242	52	421	1	373
QKX62870.1|GT32	6.58e-126	52	414	1	378
QQK48128.1|GT32	3.89e-125	128	413	68	353

PDB Hits     

An12g07020-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	7.53e-28	150	400	146	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	5.97e-22	165	400	122	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	6.72e-22	150	375	134	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	1.02e-13	141	292	91	276	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.13e-06	142	239	56	147	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999773	0.000241

TMHMM  Annotations     

Start	End
62	84