CAZyme Information: An12g03070-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An12g03070-T-p1
• CAZy Family: GH62
• CAZyme Description: Putative glucoamylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
694	An12_A_niger_CBS_513_88|CGC7	79200.26	5.4231

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An12_A_niger_CBS_513_88:790730-793191(-)

Full Sequence      

MDPANEYCGLEDYGLVGDMHTCALVSKNGSVDSMCWPVFDSPSIFCRILDKEKGGHFSIT
PDRRLKNPLSKQRYRPYTNMLETRWIHEEGVMNILDYFPIAKPKPHVACRSGMVRKAECV
RGEMEIEIELFPAFNYARDSHVAQQSSASDDAIQVYHFQAESQNLVVSVLGDRGDISGDD
SDLSIEFELSDRPGHLGPGLVGKVTLKEGQSITMLLHDQESITCNVEDLAPYLQQIERTT
GDFWSDWTSKCTFRGHYREQVERSLLVLKLLTYKPTGAIVAAPTFSLPEHIGGSRNWDYR
YSWVRDAAFTVYVFLKNGYPEEAESYINFIFERIFPPMDKNPKPGEPFLPIMITIHGERE
IPEMELEHLEGYRGSRPVRIGNGAATHIQLDIYGELMDSIYLYNKHAADISYDQWRAIRR
MIDFVIQIRHQPDQSIWEVRGPPQNFVYSKIMLWVALDRGLRLAEKRSNLPCPDRARWMH
ERDALYDEIMTKGYNSEKGFFCMSYENQDAMDAAVLIAPLVFFVAPNDPRLLSTIQKITE
VPAKGGLSVANMVSRYDTGKVDDGVGGNEGAFLMVTFWLVEAMMRQLRKTATSQFDSILS
FANHLGMFSEEVATSGEQIGNMPQAFSHLACQYMFNVIVKRKSLETCEYHIALDVEKRIL
QICYNEDISIFNKWLSISGFTYRQSFTISQLVVV

Enzyme Prediction     

No EC number prediction in An12g03070-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH15	258	630	9.2e-79	0.9778393351800554

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225922	SGA1	1.27e-122	11	630	17	596	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].
395586	Glyco_hydro_15	5.00e-76	255	630	1	411	Glycosyl hydrolases family 15. In higher organisms this family is represented by phosphorylase kinase subunits.
273702	oligosac_amyl	2.15e-13	263	628	260	603	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK41144.1|GH15	0.0	1	694	1	694
BCS16993.1|GH15	0.0	1	631	1	667
BCS05439.1|GH15	0.0	1	631	1	667
QMW26935.1|GH15	1.68e-317	7	631	8	670
QMW39015.1|GH15	1.68e-317	7	631	8	670

PDB Hits     

An12g03070-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10211|YAY3_SCHPO	7.86e-191	10	644	19	645	Uncharacterized protein C4H3.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4H3.03c PE=4 SV=1
sp|Q9HLE2|TREH_THEAC	4.91e-102	24	629	2	559	Trehalase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) OX=273075 GN=Ta0286 PE=1 SV=1
sp|A0R0W9|TREH_MYCS2	3.50e-101	5	639	37	646	Trehalase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=MSMEG_4535 PE=1 SV=1
sp|P71741|TREH_MYCTU	3.58e-100	5	639	49	658	Trehalase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2402 PE=1 SV=2
sp|Q978S7|TREH_THEVO	1.33e-98	7	629	27	601	Trehalase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) OX=273116 GN=TVG1381191 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000000

TMHMM  Annotations     

There is no transmembrane helices in An12g03070-T-p1.