CAZyme Information: An11g09030-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An11g09030-T-p1
• CAZy Family: GH5
• CAZyme Description: Has domain(s) with predicted transferase activity, transferring hexosyl groups activity and role in metabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
555	An11_A_niger_CBS_513_88|CGC1	62043.44	7.8671

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An11_A_niger_CBS_513_88:2140061-2141847(-)

Full Sequence      

MSDSRVHPSRTILLVVTTGGFTHATPVLEIGRALAERGHGIQFATLEGQESWVQSAEYDF
VKKVHHLGPGPTHEQLDGHYRRMQAWDISKGIGQAMESKYLFDSFWPQTYHGLKKIMNDP
GTRPDMIVADFFVEAANDIHVEYKLPIAVVCPNMPSFQLPCPYIPGRPGFQLPGTMTSED
TPMWLRIMNEIFFLPDLPAIIRAEKRGKKMRNDTGVFYPPHKPSKPDYLIFVNSFFGLEI
PRDLPPTAAPVGPLLSPSYPQLDDECGAFLAKHKSVLYIALGTHIILPHRDAMTIVKGVN
CLKEEGLIDGVIWAMGQTCRADLDRSTSFSLGADGPNEITLGALLDNKHPDWIFPFFAPQ
RAILDSDSTKLYFTHGGGSSANEGLYHGKPMLSMGIFSDQIANTARLVAGGVAESLSKLG
FTSDELYTKAKKILKSEDGMYRRNVVRLQRIAHVAARRKYHAADLIEELMYDNELRFEDG
KELRPMHLQTADMRMSAFKVKNWDLYAVSGLALSVALGSMWLAGRFAWSYRGAVMVQARF
IALASWYTLKNTFSK

Enzyme Prediction     

No EC number prediction in An11g09030-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	134	467	3.2e-22	0.7198952879581152

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	7.64e-45	14	469	4	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	2.80e-19	9	470	1	399	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
278624	UDPGT	5.54e-14	358	485	330	451	UDP-glucoronosyl and UDP-glucosyl transferase.
223071	egt	6.58e-10	359	456	355	451	ecdysteroid UDP-glucosyltransferase; Provisional
178584	PLN03007	6.26e-07	122	455	121	457	UDP-glucosyltransferase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK97035.1|GT1	0.0	1	555	1	555
QQK45460.1|GT1	0.0	1	555	1	554
BCR88254.1|GT1	3.34e-262	3	531	2	530
QKX59607.1|GT1	3.45e-260	1	542	1	543
QLI65751.1|GT1	3.64e-229	10	534	6	526

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IPB_A	1.14e-12	334	453	81	191	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
2O6L_A	2.96e-11	334	453	59	169	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]
7CJX_A	1.72e-10	334	447	60	164	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
5NLM_A	1.50e-07	230	469	216	470	Chain A, indoxyl UDP-glucosyltransferase [Persicaria tinctoria],5NLM_B Chain B, indoxyl UDP-glucosyltransferase [Persicaria tinctoria]
6SU6_A	1.55e-07	230	469	237	491	Complex between a UDP-glucosyltransferase from Polygonum tinctorium capable of glucosylating indoxyl and UDP-glucose [Persicaria tinctoria],6SU6_B Complex between a UDP-glucosyltransferase from Polygonum tinctorium capable of glucosylating indoxyl and UDP-glucose [Persicaria tinctoria],6SU7_A Complex between a UDP-glucosyltransferase from Polygonum tinctorium capable of glucosylating indoxyl and 3,4-Dichloroaniline [Persicaria tinctoria],6SU7_B Complex between a UDP-glucosyltransferase from Polygonum tinctorium capable of glucosylating indoxyl and 3,4-Dichloroaniline [Persicaria tinctoria],6SU7_C Complex between a UDP-glucosyltransferase from Polygonum tinctorium capable of glucosylating indoxyl and 3,4-Dichloroaniline [Persicaria tinctoria],6SU7_D Complex between a UDP-glucosyltransferase from Polygonum tinctorium capable of glucosylating indoxyl and 3,4-Dichloroaniline [Persicaria tinctoria]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6UWM9|UD2A3_HUMAN	2.17e-12	335	453	339	448	UDP-glucuronosyltransferase 2A3 OS=Homo sapiens OX=9606 GN=UGT2A3 PE=2 SV=2
sp|O97951|UDB18_MACFA	1.55e-11	334	485	340	478	UDP-glucuronosyltransferase 2B18 OS=Macaca fascicularis OX=9541 GN=UGT2B18 PE=1 SV=1
sp|Q64633|UD17_RAT	1.56e-11	151	448	184	441	UDP-glucuronosyltransferase 1A7 OS=Rattus norvegicus OX=10116 GN=Ugt1a7 PE=2 SV=1
sp|Q62452|UD19_MOUSE	2.05e-11	119	448	146	438	UDP-glucuronosyltransferase 1A9 OS=Mus musculus OX=10090 GN=Ugt1a9 PE=1 SV=3
sp|O02663|UD2B9_MACFA	2.72e-11	334	485	340	478	UDP-glucuronosyltransferase 2B9 OS=Macaca fascicularis OX=9541 GN=UGT2B9 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000014	0.000034

TMHMM  Annotations     

Start	End
503	525