CAZyme Information: An11g05970-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An11g05970-T-p1
• CAZy Family: GT71
• CAZyme Description: Has domain(s) with predicted role in cell wall macromolecule catabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383		40332.26	3.9362

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An11_A_niger_CBS_513_88:1471271-1472819(-)

Full Sequence      

MIIKSFLTLAIFASASGLAINKRFDNGDFPTGDTDPNVTSALTTTVSSTKAVSTVSSSLL
STTTAAPASGTTTGAGSPSPTQSGLSSSCDAFYYVEAGDSCWAIVNSYGNFTLNQFYSWN
PAVKSDCSGLQPDYYVCIGVAGSTTVASQTTLPATTTALAATSTGSYLPEQTGIAPNCNR
YYYVQHGDTCSDIATNQDISLNDFYSWNPAVGTTCSDLEADYWVCVGVSGGATATTTTST
STSISTVGSTTPTSNAPSPTQSGLVGDCSTYYEAKSGDSCWSIVNDKYTYLTTSLFEEWN
PAVGSDCGNLQPGYYYCVATQKQAPMPDTIHTCKKWHLVSDGDNCWLIEQDAGVTASQFN
TWNPYVGSSCANLWLGYWVCVGI

Enzyme Prediction     

No EC number prediction in An11g05970-T-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
180536	PRK06347	5.92e-11	69	363	304	576	1,4-beta-N-acetylmuramoylhydrolase.
212030	LysM	5.14e-08	180	215	1	36	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	1.23e-06	92	136	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	4.50e-06	335	379	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
197609	LysM	7.18e-06	271	318	1	44	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK40753.1|CBM50	1.65e-262	1	383	1	383
BCS04737.1|CBM50	1.24e-203	1	383	1	437
BCS16307.1|CBM50	1.39e-109	1	230	1	284
UKZ79391.1|CBM50	1.28e-76	77	383	106	424
UKZ53591.1|CBM50	3.63e-76	77	383	119	437

PDB Hits     

An11g05970-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALG0|LYSM1_ARTBC	3.55e-51	77	382	143	456	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4AVW3|LYSM5_ARTBC	1.42e-16	178	383	262	536	LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00327 PE=3 SV=2
sp|D4AZ68|LYSM3_ARTBC	4.41e-14	77	228	253	408	LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01488 PE=3 SV=1
sp|D4B4P8|LYSM2_ARTBC	7.66e-14	99	231	39	184	LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03438 PE=3 SV=1
sp|D4B5F9|PGDA_ARTBC	2.90e-12	171	228	380	437	Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03699 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000493	0.999485	CS pos: 17-18. Pr: 0.9529

TMHMM  Annotations     

There is no transmembrane helices in An11g05970-T-p1.