CAZyme Information: An11g05860-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An11g05860-T-p1
• CAZy Family: GH43
• CAZyme Description: Has domain(s) with predicted catalytic activity, hydrolase activity, hydrolyzing O-glycosyl compounds activity and role in carbohydrate metabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
556		61414.64	4.5338

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An11_A_niger_CBS_513_88:1429554-1431565(-)

Full Sequence      

MVGELAYTTVLASATRQLWCGLISRRPAHIDLSQFLYSDPCLTKSVHPLEFMVNIETHSI
QHTRELTLETEFNNDLDGVDIDWEYPGAPDLPENDPGTEEDGPNYLAFLVGLKNLLPGKS
VSIAAPASYWYLKQFPIKDMAKIVDYIVYMTYDLHGQWDAYNSNSQKGCATGNCLRSQVN
LTQTKQSLAMITKSGVPGAKVIVGVTSYGRSFKMADPNCSGTDCLYTCDRLHSDAKKGEC
TNTAGYTSAATKRTRTTLYSAWGLGGTSDWASDLQTYHDVPNPAKSWANFIQLAKAGEDP
KTDQTRNGNWTSYNCADDNVANLFDFTPSQRWKNMDTDTAWGDIIRIWNDTDSPRHTTFM
ESVVSTTHFKGQACDEMESGSCSSIGCEDGANGNHSGPAAFFILYSMAEIHKMYKKYYDG
LFMSLSIVGTALDDMENKFAPIPPEEDDTWLNILIDMITLGSLGTAGPLFNTMLKDHDWF
AGKTGSALDNAKDTTMTLVGQGTTTAKDLLSPGNEGEWTPEKQDEFSAYMGQVVYGWSNV
TSRALFEVSVLIYTQC

Enzyme Prediction     

EC	3.2.1.14:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	74	277	2.6e-29	0.6385135135135135

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119357	GH18_zymocin_alpha	1.39e-104	75	275	107	345	Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.
119365	GH18_chitinase	7.24e-27	72	213	122	267	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
214753	Glyco_18	1.27e-25	73	246	105	269	Glyco_18 domain.
395573	Glyco_hydro_18	3.05e-24	74	218	103	233	Glycosyl hydrolases family 18.
225862	ChiA	1.07e-19	75	217	167	322	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK40742.1|GH18	0.0	1	556	1	556
BCS04716.1|CBM18|GH18	5.03e-292	58	545	586	1114
BCS16285.1|CBM18|GH18	5.03e-292	58	545	586	1114
BCS23654.1|CBM18|GH18	4.03e-211	74	545	600	1112
BCS24215.1|CBM18|GH18	2.50e-203	74	545	604	1116

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JM7_A	1.10e-14	60	218	106	260	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis],6JMB_A Chain A, ofchtiv-allosamidin [Ostrinia furnacalis]
6BT9_A	1.41e-14	76	221	199	350	Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]
6JM8_A	1.10e-13	60	218	106	260	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis]
5GZU_A	2.49e-12	76	221	150	296	Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZU_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_A Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
5GZT_B	2.74e-12	76	221	401	547	Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P09805|KTXA_KLULA	1.21e-35	76	248	487	648	Killer toxin subunits alpha/beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 PE=1 SV=1
sp|Q06350|CHI2_YEAST	4.88e-12	60	216	199	352	Sporulation-specific chitinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CTS2 PE=1 SV=1
sp|E9ERT9|CHI1_METRA	4.60e-10	76	213	164	299	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1
sp|P20533|CHIA1_NIACI	5.50e-10	76	212	196	342	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
sp|O14456|CHI1_METAN	8.07e-10	76	213	164	298	Endochitinase 1 OS=Metarhizium anisopliae OX=5530 GN=chit1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000013	0.000000

TMHMM  Annotations     

There is no transmembrane helices in An11g05860-T-p1.