CAZyme Information: An11g01240-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An11g01240-T-p1
• CAZy Family: GH35
• CAZyme Description: Has domain(s) with predicted catalytic activity

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
614		65671.27	4.3468

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An11_A_niger_CBS_513_88:314583-316887(-)

Full Sequence      

MMLETSQRQLANKGSFIEGQSRASRTSPITEHALVDRLNIVACGGVSLKCSDFAPIPGVL
TASFRVYPTRCALTITFGSHVAPSMESGLDKSASRVFRYKSIKDAATVTVHNTLTNSTLS
GNVNPVYGDANEWIFNSSTVEAWLYSTLIPFWNLTGNDTYNELISKRMYSMAGLELGDSW
AESDNDTNMNHAAWALGAVTAAEMDFPADSSKESWLFYAGQAQGTLSSTFAFSNICDGGL
EISNVDIEETNKSMKDALSNGEFLQLSARLAYLTTGDNQSSYVADAVKVWDWCVDNDMVV
ESNWTINYLVTNTTASGNCTAMATNNGEYTYIYGLYMSAAAYMYNVTGAAAWEKRTKGML
NTIMNMFVDDGVIQELGMEISPDAGFSGSTWDDDTAYALKGLLASCLAVVTHLMPETVDT
IEPLLRNTAKAVAKQCSGMSNGTVCGSDWTKSTYDKDPNFFSSMSAVNAFTANLLMARNS
SSSSTTGTSTNGTSTDAGSGGSSGGLSGGDIAGIVVGSVAGAAMIAAVAFLILRKKRKQA
ESGAGVTPEKNMTTDSKGGYQAAELEPREVAELPQGAASYNFPEMDTDTAMEQPPQELPP
QELKSTKTIRYELA

Enzyme Prediction     

No EC number prediction in An11g01240-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	99	484	1.1e-56	0.9553072625698324

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	3.28e-101	101	467	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK45861.1|GH76	0.0	1	614	1	614
BCS15901.1|GH76	6.92e-279	100	614	32	550
BCS04312.1|GH76	6.92e-279	100	614	32	550
CAK46300.1|GH76	3.68e-78	102	486	41	409
BCS02707.1|GH76	3.91e-77	102	614	33	523

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	1.66e-30	144	459	82	382	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	2.39e-35	73	467	10	378	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q9P6I4|YHG6_SCHPO	1.07e-34	130	467	55	376	Putative mannan endo-1,6-alpha-mannosidase C1198.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.06c PE=3 SV=1
sp|O74556|YCZ2_SCHPO	7.42e-31	155	476	80	386	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q6FLP9|DCW1_CANGA	1.06e-30	142	455	68	363	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q9P6I3|YHG7_SCHPO	1.54e-29	155	472	73	377	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999990	0.000072

TMHMM  Annotations     

Start	End
511	533