CAZyme Information: An09g00100-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An09g00100-T-p1
• CAZy Family: GH28
• CAZyme Description: Mannosyl-inositol phosphorylceramide (MIPC) synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
302	An09_A_niger_CBS_513_88|CGC2	33902.77	7.6176

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An09_A_niger_CBS_513_88:19178-20327(+)

Full Sequence      

MHLGPFFESGLRVRHPLRPWTITGAINFSYTDDFSLTGHLSDSIQIVDACSPDALEAINN
ARPTLDPAIPNIVHQLWKTTDIREYSPTITASRESWRAMLEPFNYTVKLWTDDDVLELIK
ADYDWLLSTYEGYPHDIQRADIARLLIVHSEGGIYSDLDVNPKSAQHIQCLQRLSLQAIF
SPTAGTLGLSNHFFMAMPGSPFLQWALYEAKRRSSRLVSRGIILPYLQVFWSTGPIMVTA
AAARQRVWWLGGPSCRRAVLARGGRPGAKLSCRSCWDRAHTRSCCMLFDSGGTCLCGEGV
QW

Enzyme Prediction     

No EC number prediction in An09g00100-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	91	163	3.6e-16	0.8333333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.24e-22	65	248	78	246	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.20e-09	92	162	7	79	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK45844.1|GT32	8.76e-233	1	302	1	302
BCR98326.1|GT32	7.28e-135	28	248	27	246
BCS10670.1|GT32	9.10e-124	44	248	13	216
UNI15388.1|GT32	6.13e-94	32	251	13	237
CAP80286.1|GT32	3.18e-87	22	251	76	304

PDB Hits     

An09g00100-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14084|IMT1_SCHPO	1.49e-22	69	239	64	223	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q10323|IMT3_SCHPO	3.16e-21	68	239	56	212	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P33300|SUR1_YEAST	3.76e-20	47	248	31	219	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	6.65e-20	40	239	54	237	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999980	0.000039

TMHMM  Annotations     

There is no transmembrane helices in An09g00100-T-p1.