CAZyme Information: An08g08450-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An08g08450-T-p1
• CAZy Family: GH28
• CAZyme Description: Putative multicopper oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
594		66587.22	4.5839

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An08_A_niger_CBS_513_88:2011274-2013113(-)

Full Sequence      

MTIFLLLLGLLAPLVLCSPIRHVTPHLSHSTPIPRDMQGNSSQSPNTPWQGYDINTNYYE
TIPQTNVVREYWFDIVNTTAALDGVERPVLLVNGQFPGPTIEANWGDTVKVHVTNRMENN
GTAIHFHGIRQLYNNQMDGVAALTQCPVPPNSSYTYVWRAEEYGSSWYHSHFSLQAWEGV
FGGILIHGPSTAEYDHDLGMVFLNDWSHQTVDEMYQSVLESQNPPHFQTGLINGSNIWVT
ADNQTVGRRFQTEFVPGQRYRLRLVNAAMHTHFRFSIDNHDLTVIASDFVPIVPFTTNNV
PIGMGQRYDIIVTANQAPDNYWIRAIPQSFCSDNANSDNIKGVLHYEGAADNSDPTSTKW
DYGDDIQCLDFSLDELVPWLALDADIGGAQMAESDVDFTPFGDVPLYLWTMGGNALNISW
KDPTLQQTFEDPDKMDWKASQGVIEAAIPNKWTVLVVQTDLPVPHPIHLHGHDFYLLAQG
FGQFNPQNVTLKTHNPPRRDTALMTAATPENGGGGYMVIGFPADNPGVWLIHCHIGFHAT
EGFAQQIVERQSEFNTFFSEDLLENTCDAWDEYAKVNPYGHQYRALAGPYESGI

Enzyme Prediction     

EC	1.10.3.2:1	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	56	363	5.7e-133	0.9839743589743589

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274556	laccase	1.19e-71	68	544	3	514	laccase, plant. Members of this protein family include the copper-containing enzyme laccase (EC 1.10.3.2), often several from a single plant species, and additional, uncharacterized, closely related plant proteins termed laccase-like multicopper oxidases. This protein family shows considerable sequence similarity to the L-ascorbate oxidase (EC 1.10.3.3) family. Laccases are enzymes of rather broad specificity, and classification of all proteins scoring about the trusted cutoff of this model as laccases may be appropriate.
259923	CuRO_1_MaLCC_like	3.81e-71	66	187	1	122	The first cupredoxin domain of the fungal laccases similar to Ma-LCC from Melanocarpus albomyces. The subfamily of fungal laccases includes Ma-LCC and similar proteins. Ma-LCC is a multicopper oxidase (MCO) from Melanocarpus albomyces. Its crystal structure contains all four coppers at the mono- and trinuclear copper centers. Laccase is a blue multi-copper enzyme that catalyzes the oxidation of a variety aromatic - notably phenolic and inorganic substances coupled to the reduction of molecular oxygen to water. It has been implicated in a wide spectrum of biological activities and, in particular, plays a key role in morphogenesis, development and lignin metabolism in fungi and plants. Although MCOs have diverse functions, majority of them have three cupredoxin domain repeats that include one mononuclear and one trinuclear copper center. The copper ions are bound in several sites: Type 1, Type 2, and/or Type 3. The ensemble of types 2 and 3 copper is called a trinuclear cluster. MCOs oxidize their substrate by accepting electrons at a mononuclear copper center and transferring them to the active site trinuclear copper center. The cupredoxin domain 1 of 3-domain MCOs contains part the trinuclear copper binding site, which is located at the interface of domains 1 and 3.
259947	CuRO_2_MaLCC_like	1.46e-68	198	360	1	163	The second cupredoxin domain of the fungal laccases similar to Ma-LCC from Melanocarpus albomyces. The subfamily of fungal laccases includes Ma-LCC and similar proteins. Ma-LCC is a multicopper oxidase (MCO) from Melanocarpus albomyces. Its crystal structure contains all four coppers at the mono- and trinuclear copper centers. Laccase is a blue multi-copper enzyme that catalyzes the oxidation of a variety aromatic - notably phenolic and inorganic substances coupled to the reduction of molecular oxygen to water. It has been implicated in a wide spectrum of biological activities and, in particular, plays a key role in morphogenesis, development and lignin metabolism in fungi and plants. Laccase is composed of three cupredoxin domains that include one mononuclear and one trinuclear copper center. The copper ions are bound in several sites: Type 1, Type 2, and/or Type 3. The ensemble of types 2 and 3 copper is called a trinuclear cluster. MCOs oxidize their substrate by accepting electrons at a mononuclear copper center and transferring them to the active site trinuclear copper center. The cupredoxin domain 2 of 3-domain MCOs has lost the ability to bind copper.
274555	ascorbase	3.82e-67	68	538	1	512	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
177843	PLN02191	5.34e-60	68	549	23	546	L-ascorbate oxidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK40046.1|AA1_3|1.10.3.2	0.0	1	594	1	594
BCS01335.1|AA1_3	0.0	1	594	1	594
BCS13078.1|AA1_3	0.0	37	594	1	558
BCR86101.1|AA1_3	4.79e-271	6	594	10	586
UDD65566.1|AA1_3	5.02e-262	8	594	1	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5LWX_A	0.0	18	594	1	577	Crystal structure of the H253D mutant of McoG from Aspergillus niger [Aspergillus niger]
5LM8_A	0.0	46	594	1	549	Crystal structure of a laccase-like multicopper oxidase McoG from from Aspergillus niger [Aspergillus niger]
5LWW_A	0.0	45	594	1	550	Crystal structure of a laccase-like multicopper oxidase McoG from Aspergillus niger bound to zinc [Aspergillus niger]
3SQR_A	2.71e-147	49	573	49	567	Crystal structure of laccase from Botrytis aclada at 1.67 A resolution [Botrytis aclada],4X4K_A Structure of laccase from Botrytis aclada with full copper content [Botrytis aclada]
3V9E_A	2.71e-147	49	573	49	567	Structure of the L499M mutant of the laccase from B.aclada [Botrytis aclada]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|J5JH35|OPS5_BEAB2	5.13e-155	49	573	54	576	Oxidoreductase OpS5 OS=Beauveria bassiana (strain ARSEF 2860) OX=655819 GN=OpS5 PE=1 SV=1
sp|Q12570|LAC1_BOTFU	5.18e-153	49	579	47	554	Laccase-1 OS=Botryotinia fuckeliana OX=40559 GN=lcc1 PE=2 SV=3
sp|Q96WM9|LAC2_BOTFU	3.93e-152	49	573	49	568	Laccase-2 OS=Botryotinia fuckeliana OX=40559 GN=lcc2 PE=2 SV=1
sp|Q96UM2|LAC3_BOTFU	3.84e-118	97	546	1	451	Laccase-3 (Fragment) OS=Botryotinia fuckeliana OX=40559 GN=lcc3 PE=3 SV=1
sp|Q03966|LAC1_CRYPA	1.71e-109	15	573	12	577	Laccase OS=Cryphonectria parasitica OX=5116 GN=LAC-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000240	0.999717	CS pos: 17-18. Pr: 0.9810

TMHMM  Annotations     

There is no transmembrane helices in An08g08450-T-p1.