CAZyme Information: An08g03580-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An08g03580-T-p1
• CAZy Family: GH2
• CAZyme Description: 1,3-beta-glucanosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
301		32091.51	4.3392

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An08_A_niger_CBS_513_88:841920-843024(-)

Full Sequence      

MRASSLLPALLAAIPAVSASGTLGLSIGDKNGDSSCKSTSDYEADFDALKSVTTLVRTYS
ASDCNTAQNIVPAAKAKGFKVVLGVWADYDQSFDQDFNALKQIVPGNEDVVSAITVGSEV
LYRGSLSAQALLSKIQQVQNQFPSVTVGTVDSWNKFADGTADPIIQGGVTYLLANGFAYW
QDVDINNAPSTYSSDMTQAEDHIKQVAGANAGNIRFGNGETGWPTDGGSDYGAAKAGTQN
AAQYYKSAVCPMLQKGTDVFYFEAFDEVWKPNSTGDNGQSMDEKHWGLFTADRKLKFDVT
C

Enzyme Prediction     

No EC number prediction in An08g03580-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	25	301	2.2e-44	0.9903536977491961

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	9.25e-64	16	293	39	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	2.90e-44	23	301	1	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK45395.1|GH17	1.74e-218	1	301	1	301
BCS09817.1|GH17	6.67e-205	1	301	1	302
BCR97352.1|GH17	6.67e-205	1	301	1	302
BCR86239.1|GH17	7.15e-160	1	301	1	305
QMW46467.1|GH17	3.95e-156	1	301	1	302

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.56e-41	33	300	46	293	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.19e-40	33	300	46	293	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B2W4|BGL2_ARTBC	1.16e-118	1	301	1	301	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1
sp|P15703|BGL2_YEAST	9.71e-70	17	301	21	310	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|Q5AMT2|BGL2_CANAL	1.50e-67	7	301	6	305	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|P43070|BGL2_CANAX	2.39e-66	7	301	6	305	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|O13990|BGL2_SCHPO	7.84e-65	18	301	37	318	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000365	0.999628	CS pos: 19-20. Pr: 0.9730

TMHMM  Annotations     

There is no transmembrane helices in An08g03580-T-p1.