CAZyme Information: An07g04420-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An07g04420-T-p1
• CAZy Family: GH16
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1009	An07_A_niger_CBS_513_88|CGC2	111421.08	6.5471

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An07_A_niger_CBS_513_88:933667-937341(-)

Full Sequence      

MEHIGPASFPIRILNSSVSSDSKIDSISLARLRLPLLLKFVVALTSLCQALSVSNTSTGS
VTWDEYSLLINGERAFINAAEFHYQRLPVPEMWLDVLQKLKANGFNTISVYFFWSYHSAS
KDAYDFKTGAHNIQRLFDMAKQAGLWVIARPGPYVNAQTNAGGLALWGSDGSMGKLRTSD
EAFHQAWLPYMRKVGQIIAANQITRGGPVILCQVENELQETTHEPNNTLVTYMEQLEAVI
RDAGITVPTTHNEKGMRYVSWSRDYGNVGGAVDIYGLDTYPAGFLVGNRCDGATGFNVFR
TYYQWFMNYSWTGPIYLAEFEGGRTLTWGAPQNYDDCRSEHSTTFVDIYYKNNIGQRVTL
QSIYEGYGGTNWGHSASPVAYTSNDYMTPLRETREQWAKLWQTKLIQLFSGSAPDLLKTY
MYGNGSGYNTQATFTVLQQNETPSTTTIAFSAYLNTSLGNMTVPDIQLQGRQSKILVTDY
MFGNQTLLYSSTDVLTNAILPGHDVLALYLWEGQTGEFALKTPRNLTLQVYGASIVSSTL
HPGYQKIKYTQATGSTVLRFTNGVIVLLLDQPTAWHFWAPSTSNYPSPRPDQKLFILGPY
LVRSASVENEVLQVSGDNNGTTTLESFIGDVPIKAIEWNGQRLTATKTPYGSYTAQIPGT
EHRSVNLPSLNHWRSADSLPEAQPGYDDSRWTVANKNSTLSPQAPLTLPVLFSSDYGYYA
GAKIYRGYFDGTNHTAVNITASGGLAFGWNAWLNGHLIGGHTGDPNLSATNMTLTLPGPH
LRTMNNVITVIVDYHGHDETNIANGAGNPRGILGAYLLPGGTRTATGFKLWKIQGNAGGA
KNIDPVRGPMNEGGLYAERLGWFLPGFPASDNKEFNSTSSPLDGISKPGVRFYVTAFDLD
IDRDLDAPIGVSFSAPNGTIARVMLWVNGYQYGKYVPHIGPQTKFPVPPGIINNRGQNTL
ALSLWAQTNDGAKLDTVELFTYGLYQTDFQFDRDWSYLQPGWEGRSVYA

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	68	406	1.4e-74	0.9869706840390879

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	1.39e-66	67	394	1	302	Glycosyl hydrolases family 35.
402180	BetaGal_dom2	8.72e-51	416	576	1	180	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C-terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N-terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, pfam01301, which is N-terminal to it, but itself has no metazoan members.
404274	BetaGal_dom4_5	4.36e-40	856	970	1	111	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.
198097	BetaGal_dom2	2.48e-32	415	577	1	182	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyses the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, which is N-terminal to it, but itself has no metazoan members.
166698	PLN03059	4.08e-29	40	400	9	335	beta-galactosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK48192.1|GH35	0.0	1	1009	1	1009
BCR94715.1|GH35	0.0	32	1009	1	993
BCS07304.1|GH35	0.0	139	1009	1	886
UQC78589.1|GH35	0.0	50	1009	18	982
QSZ31820.1|GH35	0.0	44	1009	7	983

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TG7_A	7.58e-171	61	979	6	943	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]
5IFP_A	1.22e-165	61	979	46	979	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]
5IFT_A	3.38e-165	61	979	46	979	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]
4IUG_A	1.49e-159	61	979	46	977	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]
3OG2_A	6.20e-157	61	979	26	975	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B6H5X9|BGALC_PENRW	0.0	32	1003	1	975	Probable beta-galactosidase C OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=lacC PE=3 SV=1
sp|Q2UMD5|BGALC_ASPOR	0.0	38	1009	9	984	Probable beta-galactosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=lacC PE=3 SV=1
sp|B0Y752|BGALC_ASPFC	0.0	55	1009	26	983	Probable beta-galactosidase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=lacC PE=3 SV=1
sp|A1CE56|BGALC_ASPCL	0.0	58	1009	29	985	Probable beta-galactosidase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=lacC PE=3 SV=1
sp|A7EZS5|BGALC_SCLS1	0.0	45	1009	8	984	Probable beta-galactosidase C OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) OX=665079 GN=lacC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.981069	0.018917

TMHMM  Annotations     

There is no transmembrane helices in An07g04420-T-p1.