CAZyme Information: An07g01740-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An07g01740-T-p1
• CAZy Family: GH16
• CAZyme Description: protein of unknown function

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374		41452.80	6.0765

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An07_A_niger_CBS_513_88:321859-323323(-)

Full Sequence      

MTVTDTLNLSYYWEFPSNQRLRLLYLLLISVSIVSLFLRGALTYSPHQTQNREGWGPTTS
LLDEHSSLQAVENRTLGFQNVLCINLPSRTDKRDAITLGSSVTDFHVDWIEGVSAEDMDL
KAYPPHYGEPGRPIMIPGEVGNWRAHLNAMRRIVSDRLTTALIIEDDSDWDVTLKIQLHE
FALASQSLQKARKLTASRRTGPAVHVHDNVDKAPNTRIICQTRYVICTGAYAVSYNAAQK
IIAALSVLPSDEIFPPGTSSIFDVSLGRLCENGYLTCYSSFPSLIGNWRPAGSPSRNSDI
QIVQNSEGEYQEAVSSGIAQSTMLNLDKLLEGTHGTDPAIHHSVAPEANLYDKRPHLGGG
LYVLDNDTMIERKV

Enzyme Prediction     

No EC number prediction in An07g01740-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	78	251	6.1e-25	0.9779005524861878

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	4.43e-22	81	254	2	128	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
225843	COG3306	1.33e-06	77	242	1	171	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK96619.1|GT25	4.67e-278	1	374	1	374
BCS14677.1|GT25	2.72e-105	67	374	63	411
BCS03028.1|GT25	2.72e-105	67	374	63	411
CAL00889.1|GT25	4.97e-103	67	374	63	411
UDD65081.1|GT25	1.05e-63	31	347	21	352

PDB Hits     

An07g01740-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6NVG7|GT252_MOUSE	2.03e-10	76	301	338	572	Procollagen galactosyltransferase 2 OS=Mus musculus OX=10090 GN=Colgalt2 PE=2 SV=2
sp|Q8IYK4|GT252_HUMAN	8.44e-10	76	301	339	573	Procollagen galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=COLGALT2 PE=1 SV=1
sp|Q8K297|GT251_MOUSE	1.97e-09	76	255	333	521	Procollagen galactosyltransferase 1 OS=Mus musculus OX=10090 GN=Colgalt1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000030	0.000002

TMHMM  Annotations     

Start	End
21	43