CAZyme Information: An07g00240-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An07g00240-T-p1
• CAZy Family: GH16
• CAZyme Description: Has domain(s) with predicted catalytic activity

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
915		103910.07	5.8576

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An07_A_niger_CBS_513_88:44259-47006(-)

Full Sequence      

MQVLRCGIHGFHEVLGIDVDEIRFYWTIETDDKHASQLAYRVVLSTDEAAVQGDAIVESK
LAWDSGRVMSNEQRNIICKPDNGFQSTCSYYWRVTLWDQSERPHHSAVNHFFTAYPRSHL
LPPYSMNQTYMPHTSLIFRSWFEDEPNRWKAVWIGDGGDKPIYLRKAFDLAQPPARAIMF
ASGLGHFNMTVNGSPASDHRLDPGWTNYHRRVQFTAYDVTAQLQTGANVLGAHLGNGFYA
GDKGEDRFFWPMYEDNTYVRYGNELCFFSELHLFYPDGSHTTMISDPSWRVRRSATSLAN
IYASENHDRRQYPTGWDTPDFDDADWAFAKPLTGPRGHIYYQTQPPVVLHETFQPVKITE
PRPGIVCYDLGQNASTMVRVEVEGPRGSEIIVRYSETIQEDGTVLMPDPLFKEYETGVFS
RIHLAGTGAPETWEPDFSFTSARYIQVEGVSLDGSDGRPVIRSVVGRHISSAARRLGTMQ
TDKEDVNQLLSALSWTFSSNLFSYHTDCPQIEKFGWLEVTHLLAPATQYVRDMEALYTKI
LDDILDTQEPSGLVPTMAPEIRYMCGPLHDTITWGCAVCLLPDILREYYGSTHVIAKVFP
AAVRYMEYMRTKERRGGLIEHGLGDWGRGIAFGNNQANIETAIYYRCLQCVAMMARELGE
MQKAKEFEQWAARIYAVYNRHLLVTDDASRPYAYYTSLDNYPARDRDAIAQAMALQFGLV
PEQHRKDVMAAFLDDVADGRIRAGEIGLRFLFNTLADAKRPDLVLQMARQEEHPSYMRFL
RRGETTLLEFWQDECRSKCHDMLGTIYEWFYAAVLGLKPTGPAYRTFVVDPPYNAEFKHV
KGSVDCPYGTIAVEFTRNEQGQAVVNVRVPFGTTAIVKLPRSGKSSAYCREGEESRAVDG
GEVSLSHGVYSIIEG

Enzyme Prediction     

EC	3.2.1.40:1	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	358	879	2.4e-129	0.998015873015873
CBM67	160	332	5e-32	0.8693181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	6.22e-100	474	814	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
400715	Bac_rhamnosid_N	2.80e-66	173	351	2	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
336149	Bac_rhamnosid	8.45e-21	359	470	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	6.97e-19	816	885	1	69	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK39248.1|GH78	0.0	1	915	1	915
BCS07621.1|GH78	0.0	1	912	1	912
BCR95051.1|GH78	0.0	1	912	1	912
CAP83097.1|GH78	0.0	1	912	1	913
EGX44008.1|GH78	0.0	1	912	10	922

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.56e-93	15	881	44	900	Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	2.36e-79	164	900	305	1015	Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	5.59e-57	156	883	126	850	Crystal structure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q82PP4|RHA78_STRAW	1.04e-78	164	900	305	1015	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
sp|T2KPL4|PLH28_FORAG	7.47e-71	15	913	44	948	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
sp|T2KNB2|PLH20_FORAG	2.32e-65	10	886	43	885	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
sp|P9WF03|RHA78_ALTSL	2.51e-64	4	875	34	874	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000001

TMHMM  Annotations     

There is no transmembrane helices in An07g00240-T-p1.