CAZyme Information: An06g02070-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An06g02070-T-p1
• CAZy Family: GH13|GH13
• CAZyme Description: Has domain(s) with predicted polygalacturonase activity and role in carbohydrate metabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
459		49813.61	4.5485

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An06_A_niger_CBS_513_88:519773-521260(-)

Full Sequence      

MRASILPLTLFLATLAGAQLSGPVGPLVDYSTKARNQTCNIIDYGAVADGKTDISQALLD
AWGNCSVGGLVYIPPGNYSLAEDIELKHGQSSAIQLDGVVMRGHRGSYQMILIRDCNDFE
FFSGNSRGAIQGFGYEYLQNDTYGERLLRIQEVNNFSVHGFALIDSPSYYIVFDTVTSGE
VYNILIRGVTSVGATDAIDVWGENMWFHDIEVSNGDECVTVKSPAHNYLIENIYCNLSGG
TAIGSLGTGTNISDIHYRNLYMNQADACFLKSNNGDGIVKNIIWENVIVHGGPYPLAIDE
AWGDDRGSVGVQVSNLTFRNWHGESVSASRPVIRLQCDSDVPCYDITIENVNLWANDSNY
VVWQCENAYGDGACLSSAEGTKDLETFTSKQTITATPSYAAPTMAADFTFNLPSTSPFTI
PPMPTSFYPGATPISTLLHLHGAGGLPSASPISHHRRHQ

Enzyme Prediction     

EC	3.2.1.171:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	68	369	1.4e-51	0.9476923076923077

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215540	PLN03010	4.94e-27	37	373	45	394	polygalacturonase
177865	PLN02218	1.43e-26	38	368	67	418	polygalacturonase ADPG
178580	PLN03003	8.83e-20	40	353	25	357	Probable polygalacturonase At3g15720
395231	Glyco_hydro_28	2.24e-19	146	374	86	321	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
165802	PLN02155	1.21e-18	27	370	17	380	polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABD61569.1|GH28	0.0	1	459	1	459
CAK48050.1|GH28	0.0	1	459	1	459
BCS13436.1|GH28	0.0	1	457	1	457
BCS01728.1|GH28	0.0	1	457	1	457
QMW30240.1|GH28	4.52e-254	8	446	9	447

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RMG_A	3.28e-140	19	437	1	420	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QLQ5|RHGC_ASPNC	0.0	1	459	1	459	Probable rhamnogalacturonase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgC PE=3 SV=1
sp|B8NGP8|RHGC_ASPFN	8.02e-255	8	446	9	447	Probable rhamnogalacturonase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rhgC PE=3 SV=2
sp|Q2UFD2|RHGC_ASPOR	1.88e-253	8	446	9	447	Probable rhamnogalacturonase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rhgC PE=3 SV=1
sp|Q5ARE6|RHGA_EMENI	3.73e-141	8	452	6	448	Rhamnogalacturonase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rhgA PE=2 SV=2
sp|A2QYE5|RHGA_ASPNC	8.18e-141	15	437	15	439	Probable rhamnogalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000244	0.999728	CS pos: 18-19. Pr: 0.9724

TMHMM  Annotations     

There is no transmembrane helices in An06g02070-T-p1.