CAZyme Information: An06g02040-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An06g02040-T-p1
• CAZy Family: GH13|GH13
• CAZyme Description: Putative beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
865	An06_A_niger_CBS_513_88|CGC8	93674.17	5.4592

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An06_A_niger_CBS_513_88:509962-512559(+)

Full Sequence      

MPHEERVSSHVRQLLQSLTLEEKVALLAGKNMWETVNIDRLHIPSLKMTDGPAGVRGSKW
TYGSLTTWIPCGISLAATFDPAMVEQVGSVLGQEARRKGCQVLLAPTMNLSRSPLGGRNF
ESYGEDPYLVGVIATAMIRGIQAHGVGACMKHFILNDTETRRFNVDQTIDERTLREVYMK
PFTMVLNDPASTPWTAMVSYPKINGLHADISPHILPRLLRQELQFDRLVMSDWGGLNSTA
ESLRATTDLEMPGPAVRRGERLLAAIRAGEVEVAAHVDPSVRRFLQLLERTGLLGDATKS
AEHSEAATDDPIFHRIARDAAQSGLVLLKNDKGILPLKPTTLQRVAIIGPNACQPTAGGA
GSAAVNPFYVSTPESCLRDVLHAANSELQVSYEPGIPSSLRPPLLGKLLTVPDGSRKGWQ
VSFFEGHALEGPVVASSMWDDSLIYLFSDGDVPAVLDDRPYSYRATGVVTPQESGRYTWS
LANTGKAKLFVNDELLIDNTEWTGLTGGFLGCSSADKTASVYLEAGRAYQLRVDNVVTLP
VVEAFDNTLFPRISGVRVGLALEQDEPEMLAQAVAAARQADVAVVVVGHNKDSEGEGGDR
ATMQLPGRTDELVAAVCAANPNTVVVVQSASAVAMPWVDAASGLVMAWYQGQENGHALAA
ALLGDCDFSGRLPITFPRRLKDHGSHAWFPGEAAQDRNTFGEGVRVGYRHFDAQGIPALW
PFGFGLSYTRFQLTNIRVCGRVEGRSPESQPVLIQARVCNVGGRDGQEVVQVYVAPSAGI
REAGEMSFPKTLGGFCKISVPAGDSREVSIPIRGSELSWYDARVAQWRLDAGKYACWVGR
SSSHIDAELEIEVAEGEDTRQGTLE

Enzyme Prediction     

No EC number prediction in An06g02040-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	37	252	9.7e-63	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	7.47e-71	30	352	47	364	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	2.15e-47	67	842	118	754	beta-glucosidase BglX.
395747	Glyco_hydro_3	5.65e-40	40	287	63	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	1.28e-27	7	361	49	439	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	1.69e-27	588	728	99	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK48047.1|GH3	0.0	1	865	1	865
BCS13433.1|GH3	0.0	1	862	1	862
BCS01725.1|GH3	0.0	1	862	37	898
QMW31943.1|GH3	0.0	1	853	1	851
QRD91011.1|GH3	0.0	1	853	3	853

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	7.85e-145	11	853	6	836	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.60e-139	11	853	6	836	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	9.99e-107	11	853	5	668	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
4I3G_A	8.60e-101	8	853	51	828	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]
5WAB_A	6.22e-89	7	847	1	657	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P27034|BGLS_RHIRD	1.60e-169	11	853	2	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|Q5BFG8|BGLB_EMENI	1.12e-163	9	851	9	836	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|Q2U8Y5|BGLI_ASPOR	2.74e-151	11	852	6	831	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	1.07e-150	11	852	6	831	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|B0Y3M6|BGLI_ASPFC	1.13e-149	7	852	2	830	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000000

TMHMM  Annotations     

There is no transmembrane helices in An06g02040-T-p1.