CAZyme Information: An05g02310-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An05g02310-T-p1
• CAZy Family: GH13
• CAZyme Description: Mannosyl-inositol phosphorylceramide (MIPC) synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
347		39438.35	8.1719

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An05_A_niger_CBS_513_88:516379-517478(-)

Full Sequence      

MAHARIRLVLAALLLFILTSLLAPFFCNLYLLLRLPFVWKTSSANAIISQQHDGFDLTFS
DYNSTYSVADTGLSVPVPARLHHVQLGAQSPRPEWQAARDECLKQHPDWETFLWTDENAS
RFVQNYYPHFLPTWENYPHLVQRVDALRYMVLHKYGGAVLDYDLACKRSLEPLRRFEFVA
PAANPVGISVGMMLAAPNNPYVNDLVRNLPNFNRRWSFLPYITVMFSTGCHYASTIYTMQ
RQTSTLRVLTGPPENPRMHMLNGVVNTPLFRHLGSSSWHEKDARFIKAFANMDQRVAFGM
VLFALVGGCWAVSLCVYSVSGMASEGGNLARDRDVAESTWFIITCNY

Enzyme Prediction     

No EC number prediction in An05g02310-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	94	174	9.5e-21	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.33e-26	75	287	80	289	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	9.34e-15	94	177	3	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK44892.1|GT32	4.03e-263	1	347	1	347
BCS05573.1|GT32	2.95e-218	1	316	1	316
BCS17124.1|GT32	2.95e-218	1	316	1	316
UDD65563.1|GT32	5.09e-140	1	316	1	316
QMW48357.1|GT32	7.23e-140	1	316	1	316

PDB Hits     

An05g02310-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	4.72e-39	77	291	55	264	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.09e-37	74	286	54	262	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P38287|CSH1_YEAST	6.13e-37	62	291	50	272	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	5.44e-35	55	337	44	316	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q9UT67|IMT2_SCHPO	3.57e-33	77	286	82	289	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.980052	0.019983

TMHMM  Annotations     

Start	End
10	32
217	239
297	319