CAZyme Information: An05g01750-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An05g01750-T-p1
• CAZy Family: GH13
• CAZyme Description: Ortholog of A. fumigatus Af293 : Afu6g14040/och2, A. oryzae RIB40 : AO090003001503, Neosartorya fischeri NRRL 181 : NFIA_059930 and Aspergillus niger ATCC 1015 : 189528-mRNA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
417	An05_A_niger_CBS_513_88|CGC4	46777.09	4.7920

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An05_A_niger_CBS_513_88:413342-414595(-)

Full Sequence      

MGQLGQSVTMQLKTPIPAIPSMPAMPAMSGVCLPRQVRRVVPLFLAVFCLVFYLSLTGTF
AEFHGGLARQSKCRLFPRKIWQSWKVNPFEFEERDLNVARTWTSINPGYRYEVLTDQNDL
HYVETNFGPDGLNRPDIVETYRSLTAKIIKADLLRYLVMYVDGGVYADIDVEALRPLERF
IPERFNEADMDLIIGVEIDEPDFNDHAILGPKSQSFCQWTFISKPRQPVMMRLVDRILEW
LHDHSVKQGKPISDLELDFDDIISGTGPSAFTEAVLAEMSARTGQEVTWKTFHDIPESKL
VGGILVLTVEAFAAGQGHSDSGNHNARSALVKHHYHASGWPNTHPRFKHPLYGEVEQCNW
NKQCVADWDANTAAFAALSPEEQEQQIAMKQAADAAETEMAVEDLAGDDGDLGLAIE

Enzyme Prediction     

No EC number prediction in An05g01750-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	97	182	6.1e-20	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.10e-23	76	241	82	247	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.16e-14	93	183	2	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK96510.1|GT32	1.26e-297	10	417	1	408
BCS17076.1|GT32	1.58e-297	1	417	1	414
BCS05523.1|GT32	7.05e-296	1	417	102	515
QMW40889.1|GT32	9.08e-220	29	395	2	370
BAE58544.1|GT32	9.08e-220	29	395	2	370

PDB Hits     

An05g01750-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	1.08e-35	77	340	143	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	2.83e-31	76	338	99	374	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	6.41e-31	76	312	130	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	2.27e-21	77	338	97	468	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	8.50e-09	77	181	58	153	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999912	0.000118

TMHMM  Annotations     

Start	End
40	62