CAZyme Information: An04g08890-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An04g08890-T-p1
• CAZy Family: GH114
• CAZyme Description: Putative aryl-alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
544	An04_A_niger_CBS_513_88|CGC1	59561.97	4.9002

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An04_A_niger_CBS_513_88:2161506-2163390(+)

Full Sequence      

MAAGEQFDYIIVGGGTAGCVLASRLKQYNSSLSILLVEAGPDASNHPLVPDGSKATQLLG
SELDWTYDTVPQKHLHDRVLSNHAGKALGGSTTINSGGWMRGAKEDYDLWASLVGDSRWS
YHGLLPYFRKLEHHFDPFADPEVHGFEGPIKTESVSSTGRRYPLRQLVQEVWNSVGVTYN
SNINSGSPYGLVEVVENRDHGMRQMSSSVYPLDVEVMTETLVKRVLVEERDDQKVAIGVV
LEDTDESQIIARQEVIISAGAYRTPQLMMLSGIGPAEELRAYGIDIVLDLPDVGRHFADH
VAVSQWWQLKHPEKGLSIGSPAFTDPAFFRGNPIDFVALDSVPLDGLRQALVKDDPNSNP
DEHPLIASQRVHVETFTVYAAGNAQNPTIATDGTHITTGVSCMLPTSRGSIKLADRDVRS
APRIDPNYCATEADRYVLREGLRKLRKALRDTSAGQEMIESETVEENYDPLGPETDDEAL
DDLIRRRAATLYHPTGGACMGKVVDGDLRVKGIDGLRVVDASVIPTPLSTHIQACVRMGM
VDQL

Enzyme Prediction     

No EC number prediction in An04g08890-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	6	538	1.7e-140	0.9753521126760564

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.10e-86	5	526	4	510	choline dehydrogenase; Validated
225186	BetA	1.15e-85	1	538	2	524	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
215420	PLN02785	7.76e-37	5	538	54	567	Protein HOTHEAD
398739	GMC_oxred_C	1.81e-35	405	534	1	134	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.21e-27	84	302	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK38976.1|AA3_2	0.0	1	544	1	544
BCR96857.1|AA3_2	0.0	1	536	1	536
BCS09345.1|AA3_2	0.0	1	536	1	536
QKX53281.1|AA3_2	1.23e-213	7	538	3	529
QKX57982.1|AA3_2	1.08e-208	5	536	4	543

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4H7U_A	6.56e-64	1	533	35	583	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3Q9T_A	2.15e-60	4	533	4	555	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	2.98e-60	4	525	4	547	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	2.98e-60	4	525	4	547	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	1.69e-56	6	533	1	547	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1L9WN49|ACUG_ASPA1	2.12e-106	5	534	3	505	GMC-type oxidoreductase acuG OS=Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094) OX=690307 GN=acuG PE=3 SV=1
sp|Q0R4L2|PDH3_LEUMG	3.21e-64	6	533	40	581	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|Q3L243|PDH2_LEUMG	4.46e-64	1	533	35	581	Pyranose dehydrogenase 2 OS=Leucoagaricus meleagris OX=201219 GN=pdh2 PE=2 SV=1
sp|V5NC32|PDH1_AGAXA	2.33e-63	6	533	40	581	Pyranose dehydrogenase OS=Agaricus xanthodermus OX=83518 GN=pdh1 PE=1 SV=1
sp|Q3L245|PDH1_LEUMG	3.37e-63	1	533	35	583	Pyranose dehydrogenase 1 OS=Leucoagaricus meleagris OX=201219 GN=pdh1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999952	0.000078

TMHMM  Annotations     

There is no transmembrane helices in An04g08890-T-p1.