CAZyme Information: An04g05330-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An04g05330-T-p1
• CAZy Family: GH1
• CAZyme Description: Ortholog(s) have dolichyl-phosphate-mannose-glycolipid alpha-mannosyltransferase activity and role in GPI anchor biosynthetic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
466		51596.25	9.0578

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An04_A_niger_CBS_513_88:1310347-1311879(-)

Full Sequence      

MSSSLSSPATSRPSLLNPRQPIKALTVAFCLWKALVYLVIISCPGLGYDTSTSHLYHSHS
RPDVTSEDITYAHLPIPLKFVRWDSVYFLHIAENGYIFEQEWAFGYGYTRVLAYIATGRS
TCLPHRRTAVVATALSHITHYLAVLALYRLSVNVFGRDTATQRLICFLSAVLHVICPAGA
FLSAPYGESLFSFLNITGFYVYSSSFLDSKAGKRLSGDVKLLVAAILFSAATAVRSNGIL
SGILYAYDALLQLRRVWCQRLSIDACAHLSVIIISGCVIALGLVVPQVVAYSTYCVEDDI
SRPWCQWLVPSIYRYVQGHYWSVGFLRYWTVSNIPLFILAMPMLAILCRSSLWALDVAVP
FIFPRALSGVDQASSSATTASLLLRLAVPQGLLALMALTSYHVQIINRISSGYPLWYWYL
AYLVSGNWGQMRPSLQDSRTFTVAVRGMVAYALIQAILFGSFLPPA

Enzyme Prediction     

No EC number prediction in An04g05330-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	27	466	1.3e-118	0.9926289926289926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	3.96e-41	22	466	1	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	5.09e-19	82	466	76	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK38795.1|GT76	0.0	1	466	1	466
BCS01167.1|GT76	3.85e-313	1	466	1	469
BCS12914.1|GT76	3.85e-313	1	466	1	469
QMW40534.1|GT76	1.89e-192	9	466	6	452
QRD82967.1|GT76	1.89e-192	9	466	6	452

PDB Hits     

An04g05330-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJS7|GPI18_ASPOR	3.89e-190	9	466	6	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	9.33e-166	15	466	23	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	1.80e-80	20	466	9	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	1.04e-78	21	466	18	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	1.70e-45	79	466	45	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999984	0.000021

TMHMM  Annotations     

Start	End
29	48
130	152
164	186
225	247
268	290
325	347
441	463