CAZyme Information: An04g01260-T-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: An04g01260-T-p1
• CAZy Family: CE5
• CAZyme Description: Ortholog of A. nidulans FGSC A4 : AN4395, A. fumigatus Af293 : Afu4g06870, A. oryzae RIB40 : AO090023000901, Aspergillus wentii : Aspwe1_0023285 and Aspergillus sydowii : Aspsy1_0545881

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
411	An04_A_niger_CBS_513_88|CGC9	46832.02	5.9799

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerCBS513-88	14403	425011	346	14057

• Gene Location: location=An04_A_niger_CBS_513_88:316094-317535(+)

Full Sequence      

MLLPKGGVTWKSAKARLPPWRAVLFLVTRTRFLVSLAITGLVVLLWRGISKSASEMQSFY
CYGPSKSPMEMSINEMVEWTAHTQTPVLFNHHAAYEVNSSSIKTVDLNPIKSTSQAISNS
ERVLILTPLRDASEHLVNYFDLLYKLTYPHNLIDLAFLVGDCSDDTMAVLTAELSRIQDQ
VDEKIAFRSATIVQKDFGADIEMNVEDRHSFAAQGPRRKAIGRARNYLLYSALKPDHSWV
YWRDVDIFDSPDSIIEDFIAHDRDILVPNIWFHRYRDGVDVEGRFDYNSWIESDKGRRLR
ETLDPDTVLAEGYKEYDTGRTYLVGMGDWRKNKDEEVELDGIGGVNILVKADVHRTGINF
PAYAFENQAETEGFARMAKRAGYQVYGLPNYVVWHIDTDEKPGNLGGRKAY

Enzyme Prediction     

No EC number prediction in An04g01260-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	99	363	1.3e-110	0.9888059701492538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	1.73e-155	101	364	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK38583.1|GT62	4.08e-309	1	411	1	411
BCS12574.1|GT62	4.77e-308	1	411	1	411
BCS00814.1|GT62	4.77e-308	1	411	1	411
BCS29009.1|GT62	5.59e-270	1	411	1	409
BAE59398.1|GT62	5.55e-268	1	411	1	410

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	1.07e-63	106	399	10	303	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32629|ANP1_YEAST	4.90e-98	98	396	58	355	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|O74745|ANP1_SCHPO	8.88e-96	118	396	95	372	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P23642|VAN1_YEAST	6.78e-80	100	396	170	512	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	6.14e-77	96	396	70	419	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P39107|MNN9_YEAST	7.26e-65	75	399	69	393	Mannan polymerase complexes subunit MNN9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN9 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999999	0.000008

TMHMM  Annotations     

There is no transmembrane helices in An04g01260-T-p1.